MOON
Server: Apache/2.2.34 (Unix) mod_ssl/2.2.34 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 FrontPage/5.0.2.2635
System: Linux server.asjudinet.com 2.6.32-042stab141.3 #1 SMP Fri Nov 15 22:45:34 MSK 2019 i686
User: asjudine (504)
PHP: 5.2.17
Disabled: NONE
Upload Files
File: //var/lib/rpmrebuilddb.5717/__db.002
t5_
FFE$R
RRRR$R
RRR
RR$R
RRRRR$R
RRR
RRRR$R
RRRR$R
RRR
RRRR$R
RRR$R
RR
RRR$R
RRR
RRR$R
RRRRR$R
RRR
RRR$R
RRRRR$R
RR
RRR$R
RRR$R
RRR$R
RRR
RR$R
RRR
RRRRRRR$R
RRR$R
RRRRRRR$R
RRR
RR$R
RRR
RRRR$R
RR
RRRR$R
RRR
RRRR$R
RRR
RRR$R
RRRRR$R
RRR
RR$R
RRR
RRRR$?$ӏSYǁ$?PGV(%}l`KT#E.S>R&Y%`!m?PGV(U]|vo/ַzSm۹i
\c"DLm1bad1eb90574edf2b674a4d930d6b592c6d639a9PH(PEEDF


	ASCII English textASCII textBourne-Again shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedHTML document textISO-8859 C++ program textTenex C shell script text executabledirectoryemptysetuid ELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedsymbolic link to `../../bin/kill'symbolic link to `../../bin/logger'symbolic link to `../../sbin/hwclock'symbolic link to `hwclock'symbolic link to `rdev'symbolic link to `swapon'symbolic link to `vipw'%.9?EOU]cgmu| %-17>DKQW[_ept|	
		

R
RRR$R
RRR$R
RRR
RRRR$R
RRRRRR$RR
RRR
RRRRRRRRR$R
RRR
RRRRR$R	R
RRR
RRRRRR$R
RRR
RR$R
RRRRR$R	R
RRR
RRRRR$R
RRRRR$R
RRR
RRRR$R
RRRRR$R
RRR$R
RRRRR$R
RRR
RRRR$R
RRR
RRR$R
RRR
RR$RR
RRR
RRR$R
RRR
RRRR$R
RRR$R
RRR
RRRR$R
RRR
RRRRR$R
RR$R
RRR
RRR$R
RRR$R
RRR
RRRR$R	R
RRR
RRRR$R
RRRRRR$R
RRRRRRRRRRRR$R
RRR$R
RRRRRRRRRRRR$R
RRR
RR$R
RRR
RR$R
RRR
R$R
RRR
RR$R
RRRRHLDDCE	

archdmesgkillloggerloginmoremountrawtasksetumountchfnchshloginremote60-raw.rulesaddpartagettyblockdevclockctrlaltdeldelpartfdiskfsck.cramfsfsfreezehwclocklosetupmkfsmkfs.cramfsmkswapnologinpartxpivot_rootsfdiskswapoffswaponcalchfnchrtchshcolcolcrtcolrmcolumncytuneddatefdformatflockfloppygetopthexdumpioniceipcrmipcsisosizekillloggerlookmcookienameirenamerenicerevscriptsetsidsettermtailfulwhereiswritehwclockramsizerdevreadprofilerootflagstunelpvidmodevigrvipwutil-linux-2.13AUTHORSNEWSREADME.calREADME.clearREADME.colREADME.fdiskREADME.gettyREADME.htmlREADME.hwclockREADME.modems-with-agettyREADME.mountREADME.nameiREADME.poeiglgetopt-parse.bashgetopt-parse.tcshgetopt-test.bashgetopt-test.tcshsfdisk.examplesipc.info.gzutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moarch.1.gzcal.1.gzchfn.1.gzchrt.1.gzchsh.1.gzcol.1.gzcolcrt.1.gzcolrm.1.gzcolumn.1.gzddate.1.gzflock.1.gzgetopt.1.gzhexdump.1.gzionice.1.gzipcrm.1.gzipcs.1.gzkill.1.gzlogger.1.gzlogin.1.gzlook.1.gzmcookie.1.gzmore.1.gznamei.1.gzreadprofile.1.gzrename.1.gzrev.1.gzscript.1.gzsetterm.1.gztailf.1.gztaskset.1.gzul.1.gzwhereis.1.gzwrite.1.gzfstab.5.gzaddpart.8.gzagetty.8.gzblockdev.8.gzctrlaltdel.8.gzcytune.8.gzdelpart.8.gzdmesg.8.gzfdformat.8.gzfdisk.8.gzfloppy.8.gzfsfreeze.8.gzhwclock.8.gzisosize.8.gzlosetup.8.gzmkfs.8.gzmkswap.8.gzmount.8.gznologin.8.gzpartx.8.gzpivot_root.8.gzramsize.8.gzraw.8.gzrawdevices.8.gzrdev.8.gzrenice.8.gzrootflags.8.gzsetsid.8.gzsfdisk.8.gzswapoff.8.gzswapon.8.gztunelp.8.gzumount.8.gzvidmode.8.gzvigr.8.gzvipw.8.gzlastlog/bin//etc/pam.d//etc/udev/rules.d//sbin//usr/bin//usr/sbin//usr/share/doc//usr/share/doc/util-linux-2.13//usr/share/info//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8//var/log/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnu8+CCBDarches- restore PAM functionality at end of login (Bug #201)- patch top build on the arm without PAM and related utilities, for now.
- build hwclock only on intel- upgraded to version 2.9- build for Raw Hide (slang-1.2.2)
- patch kbdrate wackiness so it builds with egcs- patched more to use termcap- added warning about alpha/bsd label starting cylinder- use sigsetjmp/siglongjmp in more rather then sig'less versions- explicit attrs for setuid/setgid programs- sln is now included in glibc- add cbm1581 floppy definitions (problem #787)- remove /etc/nologin at end of shutdown/halt.- add mount/losetup.- update to 2.8 with 2.8b clean up. hostid now defunct?- "more" now works properly on sparc- Fix "fdisk -l" fault on mounted cdrom. (prob #513)- translations modified for de, fr, tr- manhattan rebuild- more didn't suspend properly on glibc
- use proper tc*() calls rather then ioctl's- fixed a security problem in chfn and chsh accepting too 
  long gecos fields- removed "." from default path- added (again) the vipw patch- minor cleanups for glibc 2.1- added vfat32 filesystem type to list recognized by fdisk- don't build clock on the alpha 
- don't install chkdupexe- Update to new pam standard.
- BuildRoot.- added rootok and setproctitle patches
- updated pam config files for chfn and chsh- updated MCONFIG to automatically determine the architecture
- added glibc header hacks to fdisk code
- rdev is only available on the intel- update to util-linux 2.7, fixed login problems- Merged Red Hat changes into main util-linux source, updated package to
  development util-linux (nearly 2.7).- LOG_AUTH --> LOG_AUTHPRIV in login and shutdown- Moved to new pam and from pam.conf to pam.d- pam.patch differentiated between different kinds of bad logins.
  In particular, "user does not exist" and "bad password" were treated
  differently.  This was a minor security hole./bin/sh/bin/shfdisktunelpmountlosetupschedutilsbuilder10.centos.org 1352366533߇h߇(߉$߇1߅߆e߆߇0߆߆߇߇߇H߇߇߆߇4߆߇߆߆V߆`߆{߆߆U߆}߆߆߆S߆^߆߆߅߆߇3߆b߇o߆߅߇n߇7߇j߇q߆߇9߅߇߆d߇m߇k߇߅߇6߅߈߈'߇<߇s߆߅߇'߇u߅߅߅߅߇;߇&߅߇߇B߇=߆߇D߇8߇C߆߇?߉%߉2߉1߉,߉/߉0߉&߉)߉'߉(߉*߉.߉-߉+߉3߉5߉4߉6߉7߆߆߆߆߆߆߆߆߆߇߇߇	߇߇߇߇߇߇߇!߇$߆u߅߅߆߅߇O߇~߅߅߅߅߇W߅߅߅߆߇K߆߆߅߅߅߆߇*߆Q߇x߅߅߆R߆߇߇U߅߆߆]߅߆߅߆߆߆5߇T߆߅߇߇\߆߅߅߆߆h߆߅߇_߆W߆߆߅߆߆߆߇߆߆߆߆߇R߇d߆߆Ncacsdadeesetfifriditjanlptruslsvtrukvi2.13-0.59.el5_82.132.132.13-0.59.el5_8,<BBAC- use snprintf - not sprintf - when doing
  sprintf ("%s\n", _("Some string")) to avoid overflows and
  segfaults.- raw control file was /dev/raw, now /dev/rawctl.
- raw access files were /dev/raw*, now /dev/raw/raw*.- -v argument to mkswap wasn't working- Recognize 0xfd on Sun disklabels as RAID- more lives in /bin, and was linked against /usr/lib/libnurses. Bad.- update to 2.10f
- fix issues in the new realpath code, avoid leaking memory- rebuild to fix dependencies
- add NFSv3 patches- don't require csh- update to 2.10e
- add rename- strip newlines in logger input.- rebuild with correct ncurses libs.- updated to util-linux 2.10c
- deprecated IMAP login mail notification patch17
- deprecated raw patch22
- depricated readprofile patch24- add patch for readprofile- tunelp should come from util-linux- kbdrate cannot use /dev/port on sparc.- fix kbdrate on sparc.- ship hwclock on alpha.- don't ship symlinks to rdev if we don't ship rdev.- add rawIO support from sct- don't display "new mail" message when the only piece of mail is from IMAP- kbdrate is now a console program- hostid is now in sh-utils. On sparc, install hostid as sunhostid (#4581).
- update to 2.9w:
-  Updated mount.8 (Yann Droneaud)
-  Improved makefiles
-  Fixed flaw in fdisk- tsort is now in textutils.- turn off setuid bit on login. Again. :(- hostid script for sparc (#3803).- added locale message catalogs to %file
- added patch for non-root build
- vigr.8 and /usr/lib/getopt  man-page was missing from file list
- /etc/fdprm really is a config file- update to 2.9v:
-   cfdisk no longer believes the kernel's HDGETGEO
    (and may be able to partition a 2 TB disk)- update to 2.9u:
-   Czech more.help and messages (Jiri Pavlovsky)
-   Japanese messages (Daisuke Yamashita)
-   fdisk fix (Klaus G. Wagner)
-   mount fix (Hirokazu Takahashi)
-   agetty: enable hardware flow control (Thorsten Kranzkowski)
-   minor cfdisk improvements
-   fdisk no longer accepts a default device
-   Makefile fix- update to 2.9t:
-   national language support for hwclock
-   Japanese messages (both by Daisuke Yamashita)
-   German messages and some misc i18n fixes (Elrond)
-   Czech messages (Jiri Pavlovsky)
-   wall fixed for /dev/pts/xx ttys
-   make last and wall use getutent() (Sascha Schumann)
    [Maybe this is bad: last reading all of wtmp may be too slow.
     Revert in case people complain.]
-   documented UUID= and LABEL= in fstab.5
-   added some partition types
-   swapon: warn only if verbose- update to 2.9s.- fix mkswap sets incorrect bits on sparc64 (#3140).- on sparc64 random ioctls on clock interface cause kernel messages.- improved raid patch (H.J. Lu).- added patch for smartraid controllers- fix logging problems caused by setproctitle and PAM interaction
  (#2045)- include docs and examples for sfdisk (#1164)- rtc is not working properly on alpha, we can't use hwclock yet.- add patch to make mkswap more 64 bit friendly... Patch from
  eranian@hpl.hp.com (ahem!)- include sfdisk (#1164)
- fix write (#1784)
- use positive logic in spec file (%ifarch rather than %ifnarch).
- (re)-use 1st matching utmp slot if search by mypid not found.
- update to 2.9o
- lastb wants bad logins in wtmp clone /var/run/btmp (#884)- if hwclock is to be compiled on sparc,
  it must actually work. Also, it should obsolete
  clock, otherwise it clashes.
- limit the swap size in mkswap for 2.2.1+ kernels
  by the actual maximum size kernel can handle.
- fix kbdrate on sparc, patch by J. S. Connell
  <ankh@canuck.gen.nz>- added pam_console back into pam.d/login- updated to 2.9i
- added hwclock for sparcs and alpha- added vigr to file list- auto rebuild in the new build environment (release 12)- remove most of the ifnarch arm stuff- added pam_console.so to /etc/pam.d/login- .perms patch to login to make it retain root in parent process
  for pam_close_session to work correctly- strip fdisk in buildroot correctly (#718)- have fdisk compiled on sparc and arm- added beos partition type to fdisk- incorporate fdisk on all vAA@Bpossible pwent structure overwriting- fdisk patch from arjan- Don't include cfdisk, since it appears to be an even bigger pile of junk than fdisk? :)- don't require usermode- Incorporate kbdrate back in.- revert the patch that calls setsid() in login that we had reverted
  locally but got integrated upstream (#46223)- correct s390x patch- Add my megapatch (various bugs)
- Include pivot_root (#44828)- make shadow files 0400, not 0600- fix permissions problem with vipw & shadow files- update to 2.11f, remove any merged patches
- add s390x patches for somewhat larger swap- added --verbose patch to mkcramfs; it's much quieter by default now- removed warning about starting partitions on cylinder 0 -- swap version2
  makes it unnecessary- Fix up s390x support- Fix up login for real (a console session should be the controlling tty)
  by reverting to 2.10s code (#36839, #36840, #39237)
- Add man page for agetty (#39287)
- 2.11b, while at it- /sbin/nologin from OpenBSD added.- Fix up login - exiting immediately even if the password is correct
  is not exactly a nice feature.
- Make definite plans to kill people who update login without checking
  if the new version works ;)- upgraded to 2.11a (kbdrate moved to kbd, among other things)
- turned off ALLOW_VCS_USE
- modified mkcramfs to not use a large number of file descriptors
- include mkfs.bfs- changed Requires: kernel >= 2.2.12-7 to Conflicts: kernel < 2.2.12-7
  (fixes a initscripts -> util-linux -> kernel -> initscripts prereq loop)- patched mkcramfs to use the PAGE_SIZE from asm/page.h instead of hard
  coding 4096 (fixes mkcramfs on alpha...)- added mkcramfs (from linux/scripts/mkcramfs)- fixed bug #29131, where ipc.info didn't have an info dir entry,
  added the dir entry to ipc.texi (Patch58)- use lang finder script
- install info files- reverted login patch; seems to cause problems
- added agetty- updated kill man page
- added patch to fix vipw race
- updated vipw to edit /etc/shadow and /etc/gshadow, if appropriate
- added patch to disassociate login from tty, session, and pgrp- fixed problem w/ empty extended partitions
- added patch to fix the date in the more man page
- set OPT to pass optimization flags to make rather then RPM_OPT_FLAG
- fixed fdisk -l /Proc/partitions parsing
- updated to 2.10s- danish translations added- fix segfault in login in btmp patch (#24025)- ported to s390- update to 2.10p
- update patch37 to newer fdisk version- update to 2.10o
-  fdformat: fixed to work with kernel 2.4.0test6 (Marek Wojtowicz)
-  login: not installed suid
-  getopt: by default install aux files in /usr/share/misc
- update to 2.10n:
-  added blockdev.8
-  change to elvtune (andrea)
-  fixed overrun in agetty (vii@penguinpowered.com)
-  shutdown: prefer umounting by mount point (rgooch)
-  fdisk: added plan9
-  fdisk: remove empty links in chain of extended partitions
-  hwclock: handle both /dev/rtc and /dev/efirtc (Bill Nottingham)
-  script: added -f (flush) option (Ivan Schreter)
-  script: added -q (quiet) option (Per Andreas Buer)
-  getopt: updated to version 1.1.0 (Frodo Looijaard)
-  Czech messages (Jiri Pavlovsky)
- login.1 man page had not /var/spool/mail path (#16998).
- sln.8 man page (but not executable) included (#10601).
- teach fdisk 0xde(Dell), 0xee(EFI GPT), 0xef(EFI FAT) partitions (#17610).- rebuild to cope with glibc locale binary incompatibility, again- setfdprm should open with O_WRONLY, not 3.- fdformat should open with O_WRONLY, not 3.- make 'look' look in /usr/share/dict- put /usr/local/sbin:/usr/local/bin in root's path- rebuild to cope with glibc locale binary incompatibility- automatic rebuild- enable hwclock to use /dev/efirtc on ia64 (gettext is fun. :( )- move cfdisk to /usr/sbin, it depends on /usr stuff
- add rescuept- point more at the correct path to vi (for "v"), Bug #10882- FHS packaging changes.- modify PAM setup to use system-auth- eek, where did login go? (specfile tweaks)- 2.10k
- fix compilation with current glibc- 2.10h- rebuild for sparc baud rates > 38400.؁f@@?Abuilt- ipcs-84243.patch to fix #84243- Update moremisc patch to fix swprintf()'s minimum field (bug #83361).- Fix mcookie segfault on many 64-bit architectures (bug #83345).- Fix underlined multibyte characters (bug #83376).- rebuild to have again a s390 rpm
- disable some more apps for mainframe- util-linux-2.11y-umask-82552.patch- rebuilt- Fix #81069, #75421- Update to 2.11y
- Fix #80953
- Update patch0, patch107, patch117, patch120 for 2.11y
- Remove patch60, patch61, patch207, patch211, patch212, patch119, patch121
- Remove patch122, patch200- Remove some crack/unnecessary patches while submitting stuff upstream.
- Build with -D_FILE_OFFSET_BITS=64- Update to 2.11w, resolve patch conflicts- Extended util-linux-2.11b-s390x patch to work again.- Add patch122 for hwclock on x86_64- Fixed pam config files- Port to hammer- Patch120 (hwclock) to fix #72140
- Include isosize util- Patch120 (skipraid2) to fix #70353, because the original patch was 
totally useless.- Patch119 (fdisk-add-primary) from #67898- Really add the gptsize patch, instead of what I think the patch says.
(+1)- Add the sp[n].size part of the patch from #69603- adjust mainframe patches- only require usermode if we're shipping kbdrate here- Port the large swap patch to new util-linux... the off_t changes 
  now in main aren't sufficient- Remove swapondetect (patch301) until it avoids possible false positives.- Update to 2.11r, wheeee
- Remove unused patches- Make a note here that this package was the source of the single change 
contained in util-linux-2.11f-18 (in 7.2/Alpha), and also contains the 
rawman patch from util-linux-2.11f-17.1 (in 2.1AS).
- Package has no runtime deps on slang, so remove the BuildRequires: 
slang-devel.- automated rebuild- Fix teg's swapondetect patch to not print out the usage message when 
'swapon -a -e' is run. (#66690) (edit existing patch)
- Apply hjl's utmp handling patch (#66950) (patch116)
- Fix fdisk man page notes on IDE disk partition limit (#64013) (patch117)
- Fix mount.8 man page notes on vfat shortname option (#65628) (patch117)
- Fix possible cal overflow with widechars (#67090) (patch117)- support large swap partitions
- add '-d' option to autodetect available swap partitions- automated rebuild- Remove kbdrate (again).- adjust mainframe patches to apply to current rpm
- do not include fdisk until it is fixed to work on mainframe- Don't strip binaries - rpm does it for us.- Apply patch115 from ejb@ql.org for bug #61868- Finish fixing #60675 (ipcrm man page), updated the patch.
- Fix #61203 (patch114 - dumboctal.patch).- Update ctty3 patch to ignore SIGHUP while dropping controlling terminal- Update ctty3 patch to drop controlling terminal before forking.Fix various bugs:
- Add patch110 (skipraid) to properly skip devices that are part of a RAID array.
- Add patch111 (mkfsman) to update the mkfs man page's "SEE ALSO" section.
- remove README.cfdisk
- Include partx
- Fix 54741 and related bugs for good(hah!) with patch113 (ctty3)- Put kbdrate in, add usermode dep.- Fix #60363 (tweak raw.8 man page, make rawdevices.8 symlink).- remove kbdrate (fixes kbd conflict)- Add util-linux-2.11n-ownerumount.patch (#56593)
- Add patch102 (util-linux-2.11n-colrm.patch) to fix #51887
- Fix #53452 nits.
- Fix #56953 (remove tunelp on s390)
- Fix #56459, and in addition switch to using sed instead of perl.
- Fix #58471
- Fix #57300
- Fix #37436
- Fix #32132- Update to 2.11n
- Merge mount/losetup back in.- Add patch38 (util-linux-2.11f-ctty2.patch) to ignore SIGINT/SIGTERM/SIGQUIT in the parent, so that ^\ won't break things.- Merge patches 36, 75, 76, and 77 into patch #37, to attempt resolve all the remaining issues with #54741.- add nologin man-page for s390/s390x- Don't build kbdrate on s390/s390x
- Don't make the pivot_root.8 man page executable(!)- Patch/idea #76 from HJL, fixes bug #54741 (race condition in login 
acquisition of controlling terminal).- fix permissions problem with vipw & shadow files, again (doh!)- added patch from Olaf Kirch to fix `U??>@P protocol if specified on
  command line as well as made NFS umounts adhere to the
  current IP protocol. Fix #140016- Add include_raw macro, build with it off for Fedora- Add raw patch to allow binding of devices not yet in /dev- Add David Zeuthen's patch to enable the pamconsole flag #133941- Restore raw utils (bugzilla #130016)- Add the missing remote entry in pam.d- Rechecked in some missing NFS mounting code.- Make swaplabel support work with swapon -a -e- Updated the NFS and NFS4 code to the latest CITI patch set
  (in which they incorporate a number of our local patches).- Fix #132196 - turn on SELinux support at build-time.- Fix #91174 with pamstart.patch- Fix #16415, #70616 with rdevman.patch
- Fix #102566 with loginman.patch
- Fix #104321 with rescuept.patch (just use plain lseek - we're in _FILE_OFFSET_BITS=64 land now)
- Fix #130016 - remove raw.
- Re-add agetty (replacing it with mgetty is too much pain, and mgetty is much larger)- Made the NFS security checks more explicit to avoid confusion
  (an upstream fix)
- Also removed a compilation warning- Remove unused mount libdevmapper inclusion.- Add device-mapper mount-by-label support
- Fix segfault in mount-by-label when a device without a label is present.- Updated nfs man page to show that intr are on by
  default for nfs4- modified warning causing heart attack for >16 partitions, #107824- Fix #126623, #126572
- Patch cleanup
- Remove agetty (use mgetty, agetty is broken)- rebuilt- Update to 2.12a
- Fix #122448- Change pam_selinux to run last- Fix #122448 (autofs issues)- Fix #119157 by editing the patch
- Add patch145 to fix #119986- Fix #118803- mkcramfs: use PAGE_SIZE for default blocksize (#118681)- Updated the nfs-mount.patch to correctly 
  handle the mounthost option and to ignore 
  servers that do not set auth flavors- Fix selinux ordering or pam for login- Make RPC error messages displayed with -v argument
- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running
- Ping NFS v4 servers before diving into kernel
- Make v4 mount interruptible which also make the intr option on by default- Reworked how the rpc.idmapd and rpc.gssd checks were
  done due to review comments from upstream.
- Added rpc_strerror() so the '-v' flag will show RPC errors.- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running.- Reworked and updated the nfsv4 patches.- Bump version- Tried to make nfs error message a bit more meaninful
- Cleaned up some warnings- Added pesudo flavors for nfsv4 mounts.
- Added BuildRequires: libselinux-devel and Requires: libselinux
  when WITH_SELINUX is set.- check for 2.6.3 kernel in mount options- Remove /bin/kill for #116100- rebuilt- rebuilt- Final 2.12 has been out for ages - might as well use it.- Added mount patches that have NFS version 4 support- Provides: mount losetup- Add multiple to /etc/pam.d/login for SELinux- 2.12pre-1
- Merge mount/losetup packages into the main package (#112324)
- Lose separate- remove selinux code from login and use pam_selinux- turn on selinux- Add BuildRequires: texinfo (from a bug# I don't remember)
- Fix #90588 with mountman patch142.- turn off selinux- turn on selinux
- remove context selection- Add patch140 (alldevs) to fix #101772. Printing the total size of
  all devices was deemed a lower priority than having all devices
  (e.g. /dev/ida/c0d9) displayed.- turn off selinux- turn on selinux- Fix #103004, #103954- turn off selinux- build with selinux- Use urandom instead for mkcramfs- add SELINUX 2.5 support- #100433 patch- #97381 patch- rebuilt- Change patch128 to improve ipcs -l- Fix #85407- Change patch128 to util-linux-2.11f-ipcs-84243-86285.patch to get all
ipcs fixes- fix last login date display on AMD64 (#88574)- include sfdisk on ppc- add patch from msw to change mkcramfs blocksize with a command line option- Fix segfault on s390x due to wrong usage of BLKGETSIZE.- Really apply the ipcs patch. Doh.- reD>>=?e xen guest shows no disks- bump again for double-long bug on ppc(64)- add "blockdev --rmpart N <device>" and "blockdev --rmparts <device>"- rebuilt for new gcc4.1 snapshot and glibc changes- Updated the gssd_check() and idmapd_check(), used with
  nfsv4 mounts, to looked for the correct file in /var/lock/subsys
  which stops bogus warnings.- fix #174676 - hwclock audit return code mismatch
- fix #176441: col truncates data
- fix #174111 - mount allows loopback devices to be mounted more than once to the same mount point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
                is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only use reserve ports when necessary
  (bz# 141773)- Update to util-linux-2.12p. This changes swap header format
  from - you may need to rerun mkswap if you did a clean install of
  FC3.- Update to util-linux-2.12j- Corrected a buffer overflow problem with nfs mounts.
  (bz# 141733)- Patches for various bugs.- Made NFS mounts adhere to the I3==<>e unused patches- use absolute path to /bin/raw in udev rule- fix #211827 - Can't mount with additional contexts
- fix #213127 - mount --make-unbindable does not work
- fix #216489 - SCHED_BATCH option missing in chrt
- fix #216712 - issues with raw device support
  (disable raw0 usage, move the raw command to /bin, update man page)
- fix #216664 - we need to the raw script and configuration file- fix #209911 - losetup.8 updated (use dm-crypt rather than deprecated cryptoloop)
- fix #210338 - spurious error from '/bin/login -h $PHONENUMBER' (bug in IPv6 patch)
- fix #208634 - mkswap "works" without warning on a mounted device- remove obsolete NFS code and patches (we use /sbin/mount.nfs
  and /sbin/umount.nfs from nfs-utils now)
- move nfs.5 to nfs-utils- fix #205038 - mount not allowing sloppy option (exports "-s"
  to external /sbin/mount.nfs(4) calls) 
- fix minor bug in util-linux-2.13-mount-twiceloop.patch
- fix #188193- util-linux should provide plugin infrastructure for HAL- fix Makefile.am in util-linux-2.13-mount-context.patch
- fix #201343 - pam_securetty requires known user to work
                (split PAM login configuration to two files)
- fix #203358 - change location of taskset binary to allow for early affinity work- fix #199745 - non-existant simpleinit(8) mentioned in ctrlaltdel(8)- Change keycreate line to happen after pam_selinux open call so it gets correct context- fix #176494 - last -i returns strange IP addresses (patch by Bill Nottingham)- fix #198300, #199557 - util-linux "post" scriptlet failure- Added the -o fsc flag to nfsmount.- rebuild- add Requires(post): libselinux- add IPv6 support to the login command (patch by Milan Zazrivec)
- fix #198626 - add keyinit instructions to the login PAM script 
  (patch by David Howells)- rebuild- cleanup dependences for post and preun scriptlets- silence install in minimal buildroot without /var/log- include the raw command for RHELs- move install-info parts from postun to preun- Only execute chcon on machines with selinux enabled- Remove unneeded header files from nfsmount.c- fix #187014 - umount segfaults for normal user
- fix #183446 - cal not UTF-8-aware
- fix #186915 - mount does not translate SELIinux context options though libselinux
- fix #185500 - Need man page entry for -o context= mount option
- fix #152579 - missing info about /etc/mtab and /proc/mounts mismatch
- fix #183890 - missing info about possible ioctl() and fcntl() problems on NFS filesystem
- fix #191230 - using mount --move results in wrong data in /etc/mtab
- added mount subtrees support
- fdisk: wrong number of sectors for large disks (suse#160822)
- merge fdisk-xvd (#182553) with new fdisk-isfull (#188981) patch 
- fix #181549 - raw(8) manpage has old information about dd
- remove asm/page.h usage- Remove requirement on restorecon, since we can do the same thing
- with chcon/matchpathcon, and not add requirement on policycoreutils- Fixed bug in patch for bz183713 which cause nfs4 mounts to fail.- Added syslog logging to background mounts as suggested
  by a customer.- fix #183713 - foreground mounts are not retrying as advertised
- fix #151549 - Added 'noacl' mount flag
- fix #169042 - Changed nfsmount to try udp before using tcp when rpc-ing
                the remote rpc.mountd (iff -o tcp is not specified).
                This drastically increases the total number of tcp mounts
                that can happen at once (ala autofs).- Better calling of restorecon as suggested by Bill Nottingham
- prereq restorecon to avoid ordering issues- restorecon /var/log/lastlog- fix #181782 - mkswap selinux relabeling (fix util-linux-2.13-mkswap-selinux.patch)- fix #181782 - mkswap should automatically add selinux label to swapfile
- fix #180730 - col is exiting with 1 (fix util-linux-2.12p-col-EILSEQ.patch)
- fix #181896 - broken example in schedutils man pages
- fix #177331 - login omits pam_acct_mgmt & pam_chauthtok when authentication is skipped.
- fix #177523 - umount -a should not unmount sysfs
- fix #182553 - fdisk -l insid "<<;=ristian Gafton <gafton@redhat.com>Michael Fulbright <msf@redhat.com>Michael Fulbright <msf@redhat.com>Erik Troan <ewt@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>- fix #865791 - fdisk fails to partition disk not in use- fix #768382 - CVE-2011-1675 CVE-2011-1677 util-linux various flaws- fix #677452 - util-linux fails to build with gettext-0.17- fix #646300 - login doesn't update /var/run/utmp properly
- fix #726572 - import missing fsfreeze into util-linux 
- fix #678430 - fdisk should not report error on 1gB LUNs
- fix #699639 - mount man page is missing support for ext4/xfs
- fix #650937 - blockdev man page missing information
- fix #678407 - ipcs and ipcrm in wrong man section- fix bug in util-linux-2.13-mount-fsname.patch- fix #245578 - "remote" PAM configuration inits the keyring at an inconvenient time
- fix #612423 - /etc/udev/rules.d/60-raw.rules gets trashed by util-linux on update
- fix #559302 - spurious mount warning when /bin/mount not setuid root- fix #448919 - fdisk -l shows wrong partition name on device-mapper-multipath devices
- fix #465911 - ipcs returns 0 when some errors occured. 
- fix #470497 - blockdev man page missing information
- fix #475509 - when executing 'mount -a', a filesystem is mounted duplicative
- fix #488192 - login: access("/nfs-home/.hushlogin", R_OK) = -1 EACCES
- fix #490693 - Add utempter support to "script"
- fix #495192 - login command does not allow for switching users
- fix #502639 - SR#1919756-remove sleep() from fdisk
- fix #565946 - sfdisk does not ensure writes make it to disk
- fix #513369 - flock segfaults when file name is not given
- fix #515149 - man mount(8) doesn't describe all vfat options for non-UTF8 locale
- fix #568194 - remount of bind mounts is not properly documented
- fix #458055 - "cal -3" generates improperly formatted output- fix #471369 - RHEL5: fdisk cannot create partition with starting beyond 1 TB- fix #509334 - /bin/raw man page needs de-deprecate rawdevices- fix #501870 - util-linux %post scriptlet failed- re-fix #240131 - mkfs:bug in mkfs man page (fix typo)
- re-fix #427183 - in repair mode, mount gives false information
- re-fix #446648 - obsolete info in fdisk(8) man page (fix typo)- fix #461266 - /usr/bin/logger symlink necessary (related to #449777)- fix #203869 - RHEL5: login segfaults on EOF
- fix #456378 - RHEL5: audit log injection attack via login
- fix #449777 - /usr/bin/logger cannot be used when /usr non-root partition
- fix #249438 - man fstab refers to fstab-sync
- fix #240131 - mkfs:bug in mkfs man page
- fix #446648 - obsolete info in fdisk(8) man page
- fix #447265 - VMware fdisk partitions
- fix #354791 - blockdev command calls the blkpg ioctl with a wrong data structure
- fix #444650 - mkswap defaults to v0 format on ppc64
- fix #458437 - "swapon -a" does not complain about missing devices
- fix #449143 - fdisk fails to warn on large disks
- fix #446971 - sfdisk issue on large hard drives
- fix #239721 - script: result of 'COMMAND' cannot be logged in the file typescript
- fix #427183 - in repair mode, mount gives false information- fix #435722 - Add support for _rnetdev mount option- fix #324471 - CVE-2007-5191 util-linux (u)mount doesn't drop privileges
               properly when calling helpers- fix #237659 - add -r option to losetup to create a read-only loop
- fix #235495 - mount -f does not work with NFS-mounted file system
- fix #234303 - src.rpm does't build
- fix #228731 - sfdisk doesn't support DM-MP device (add default heads and sectors)
- fix #231192 - ipcs is not printing correct values on pLinux
- fix #245533 - translation files exist, but are not being used- fix #222293 - undocumented partx,addpart, delpart- fix #219569 - smbfs -> cifs (upgrade from -pre6 to -pre7 upstream version)
- fix #218915 - fdisk -b 4K
- remov(;;:<Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-10Elliot Lee <sopwith@redhat.com> 2.11f-9Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-7Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-2Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-1Preston Brown <pbrown@redhat.com> 2.11a-4Bernhard Rosenkraenzer <bero@redhat.com> 2.11a-3Erik Troan <ewt@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Tim Powers <timp@redhat.com>Preston Brown <pbrown@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Oliver Paukstadt <oliver.paukstadt@millenux.com>Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Prospector <bugzilla@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Peter Jones, <pjones@redhat.com>Christian 'Dr. Disk' Hechelmann <drdisk@tc-gruppe.de>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Michael Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>David S. Miller <davem@dm.cobaltmicro.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Mike Wangsmo <wanger@redhat.com>C0::9;a-6Steve Dickson <SteveD@RedHat.com>Alasdair Kergon <agk@redhat.com>Alasdair Kergon <agk@redhat.com>Steve Dickson <SteveD@RedHat.com>Jindrich Novy <jnovy@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-1Dan Walsh <dwalsh@RedHat.com> 2.12-19Elliot Lee <sopwith@redhat.com> 2.12-18Elliot Lee <sopwith@redhat.com> 2.12-17Elliot Lee <sopwith@redhat.com> 2.12-16Jeremy Katz <katzj@redhat.com> 2.12-15<SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com> 2.12-13<SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com>Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com> Dan Walsh <dwalsh@redhat.com> 2.12-5Elliot Lee <sopwith@redhat.com> 2.12-4Dan Walsh <dwalsh@redhat.com> 2.12-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12-1Steve Dickson <SteveD@RedHat.com> 2.12pre-4Elliot Lee <sopwith@redhat.com> 2.12pre-3Dan Walsh <dwalsh@redhat.com> 2.12pre-2Elliot Lee <sopwith@redhat.com> 2.12pre-1Dan Walsh <dwalsh@redhat.com> 2.11y-35.selDan Walsh <dwalsh@redhat.com> 2.11y-34.selElliot Lee <sopwith@redhat.com> 2.11y-34Dan Walsh <dwalsh@redhat.com> 2.11y-33Dan Walsh <dwalsh@redhat.com> 2.11y-32.selElliot Lee <sopwith@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-30.selElliot Lee <sopwith@redhat.com> 2.11y-28Dan Walsh <dwalsh@redhat.com> 2.11y-27Dan Walsh <dwalsh@redhat.com> 2.11y-26.selElliot Lee <sopwith@redhat.com> 2.11y-25Dan Walsh <dwalsh@redhat.com> 2.11y-24Elliot Lee <sopwith@redhat.com> 2.11y-22Elliot Lee <sopwith@redhat.com> 2.11y-20Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-17Elliot Lee <sopwith@redhat.com> 2.11y-16Elliot Lee <sopwith@redhat.com> 2.11y-15Matt Wilson <msw@redhat.com> 2.11y-14Jeremy Katz <katzj@redhat.com> 2.11y-13Jeremy Katz <katzj@redhat.com> 2.11y-12Phil Knirsch <pknirsch@redhat.com> 2.11y-11Elliot Lee <sopwith@redhat.com> 2.11y-10Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-8Yukihiro Nakai <ynakai@redhat.com> 2.11y-7Elliot Lee <sopwith@redhat.com> 2.11y-6Tim Waugh <twaugh@redhat.com> 2.11y-5Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11y-4Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-2Elliot Lee <sopwith@redhat.com> 2.11y-1Elliot Lee <sopwith@redhat.com> 2.11w-2Elliot Lee <sopwith@redhat.com> 2.11w-1Phil Knirsch <pknirsch@redhat.com> 2.11r-10hammer.3Elliot Lee <sopwith@redhat.com> 2.11r-10hammer.2Than Ngo <than@redhat.com> 2.11r-10hammer.1Bernhard Rosenkraenzer <bero@redhat.com> 2.11r-10hammerElliot Lee <sopwith@redhat.com> 2.11r-10Elliot Lee <sopwith@redhat.com> 2.11r-9Elliot Lee <sopwith@redhat.com> 2.11r-8Elliot Lee <sopwith@redhat.com> 2.11r-7Elliot Lee <sopwith@redhat.com> 2.11r-6Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 2.11r-4Trond Eivind Glomsrod <teg@redhat.com> 2.11r-3Elliot Lee <sopwith@redhat.com> 2.11r-2Elliot Lee <sopwith@redhat.com> 2.11r-1Elliot Lee <sopwith@redhat.com> 2.11n-19Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-17Trond Eivind Glomsrod <teg@redhat.com> 2.11n-16Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-14Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11n-12Elliot Lee <sopwith@redhat.com> 2.11n-11Elliot Lee <sopwith@redhat.com> 2.11n-10Elliot Lee <sopwith@redhat.com> 2.11n-9Elliot Lee <sopwith@redhat.com> 2.11n-8Elliot Lee <sopwith@redhat.com> 2.11n-7Elliot Lee <sopwith@redhat.com> 2.11n-6Elliot Lee <sopwith@redhat.com> 2.11n-5Bill Nottingham <notting@redhat.com> 2.11n-4Elliot Lee <sopwith@redhat.com> 2.11n-3Elliot Lee <sopwith@redhat.com> 2.11n-1Elliot Lee <sopwith@redhat.com> 2.11f-17Elliot Lee <sopwith@redhat.com> 2.11f-16Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com> 2.11f-14Elliot Lee <sopwith@redhat.com> 2.11f-138998:8`8zV`8M`8M`84v8(`8 `8u7t7Պ77
`7Ÿ777f`7f`77`7|`7s7Pc`7a`7a`77766`666``66`6k6w`66`66t`6t`6`6i6g	6SC`68`6#`6"{6`5`555`5`55s$`5K`5A`5/4`4`4`44Nw`4G4>`44`4*4`3`33]43I3`Karel Zak <kzak@redhat.com> 2.13-0.59.el5_8Karel Zak <kzak@redhat.com> 2.13-0.59Karel Zak <kzak@redhat.com> 2.13-0.58Karel Zak <kzak@redhat.com> 2.13-0.57Karel Zak <kzak@redhat.com> 2.13-0.56Karel Zak <kzak@redhat.com> 2.13-0.55Karel Zak <kzak@redhat.com> 2.13-0.54Karel Zak <kzak@redhat.com> 2.13-0.53Karel Zak <kzak@redhat.com> 2.13-0.52Karel Zak <kzak@redhat.com> 2.13-0.51Karel Zak <kzak@redhat.com> 2.13-0.50Karel Zak <kzak@redhat.com> 2.13-0.49Karel Zak <kzak@redhat.com> 2.13-0.48Peter Jones <pjones@redhat.com> 2.13-0.47Karel Zak <kzak@redhat.com> 2.13-0.46Karel Zak <kzak@redhat.com> 2.13-0.45Karel Zak <kzak@redhat.com> 2.13-0.44Karel Zak <kzak@redhat.com> 2.13-0.43.3Karel Zak <kzak@redhat.com> 2.13-0.43.2Karel Zak <kzak@redhat.com> 2.13-0.43.1Karel Zak <kzak@redhat.com> 2.13-0.43Karel Zak <kzak@redhat.com> 2.13-0.42Karel Zak <kzak@redhat.com> 2.13-0.41Karel Zak <kzak@redhat.com> 2.13-0.40Karel Zak <kzak@redhat.com> 2.13-0.39Dan Walsh <dwalsh@redhat.com> 2.13-0.38Karel Zak <kzak@redhat.com> 2.13-0.37Karel Zak <kzak@redhat.com> 2.13-0.36Steve Dickson <steved@redhat.com> 2.13-0.35Karel Zak <kzak@redhat.com> 2.13-0.34Karel Zak <kzak@redhat.com> 2.13-0.33Karel Zak <kzak@redhat.com> 2.13-0.32Jesse Keating <jkeating@redhat.com> - 2.13-0.31.1Karel Zak <kzak@redhat.com> 2.13-0.31Karsten Hopp <karsten@redhat.de> 2.13-0.30Karel Zak <kzak@redhat.com> 2.13-0.29 Florian La Roche <laroche@redhat.com> 2.13-0.28Dan Walsh <dwalsh@RedHat.com> 2.13-0.27Steve Dickson <steved@redhat.com> 2.13-0.26Karel Zak <kzak@redhat.com> 2.13-0.25Dan Walsh <dwalsh@RedHat.com> 2.13-0.24Steve Dickson <steved@redhat.com> 2.13-0.23Steve Dickson <steved@redhat.com> 2.13-0.22Steve Dickson <steved@redhat.com> 2.13-0.21Jesse Keating <jkeating@redhat.com> 2.13-0.20Jesse Keating <jkeating@redhat.com> 2.13-0.19Karel Zak <kzak@redhat.com> 2.13-0.17Karel Zak <kzak@redhat.com> 2.13-0.16Jesse Keating <jkeating@redhat.com> - 2.13-0.15.1Peter Jones <pjones@redhat.com> 2.13-0.15Jesse Keating <jkeating@redhat.com> - 2.13-0.14.1Steve Dickson <steved@redhat.com> 2.13-0.14Karel Zak <kzak@redhat.com> 2.13-0.13Karel Zak <kzak@redhat.com> 2.13-0.12Jesse Keating <jkeating@redhat.com>Karel Zak <kzak@redhat.com> 2.13-0.11.pre6Karel Zak <kzak@redhat.com> 2.13-0.10.pre5Karel Zak <kzak@redhat.com> 2.13-0.9.pre5Karel Zak <kzak@redhat.com> 2.13-0.8.pre5Karel Zak <kzak@redhat.com> 2.13-0.7.pre5Karel Zak <kzak@redhat.com> 2.13-0.6.pre5Karel Zak <kzak@redhat.com> 2.13-0.5.pre4Karel Zak <kzak@redhat.com> 2.13-0.4.pre4Steve Dickson <steved@redhat.com> 2.13-0.3.pre3Karel Zak <kzak@redhat.com> 2.13-0.3.pre2Karel Zak <kzak@redhat.com> 2.13-0.2.pre2Karel Zak <kzak@redhat.com> 2.12p-9.7Karel Zak <kzak@redhat.com> 2.12p-9.5Jeremy Katz <katzj@redhat.com> - 2.12p-9.3Karel Zak <kzak@redhat.com> 2.12p-9.2Karel Zak <kzak@redhat.com> 2.12p-9Karel Zak <kzak@redhat.com> 2.12p-8Karel Zak <kzak@redhat.com> 2.12p-7Steve Dickson <SteveD@RedHat.com> 2.12p-5Karel Zak <kzak@redhat.com> 2.12p-4Elliot Lee <sopwith@redhat.com> 2.12p-3Steve Dickson <SteveD@RedHat.com> 2.12p-2Elliot Lee <sopwith@redhat.com> 2.12p-1Elliot Lee <sopwith@redhat.com> 2.12j-1Steve Dickson <SteveD@RedHat.com> 2.12a-20Elliot Lee <sopwith@redhat.com> 2.12a-19Steve Dickson <SteveD@RedHat.com> 2.12a-18Elliot Lee <sopwith@redhat.com> 2.12a-16Stephen C. Tweedie <sct@redhat.com> - 2.12a-15John (J5) Palmieri <johnp@redhat.com> 2.12a-14Stephen C. Tweedie <sct@redhat.com> 2.12a-13Phil Knirsch <pknirsch@redhat.com> 2.12a-12Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com> 2.12a-10Steve Dickson <SteveD@RedHat.com>Nalin Dahybhai <nalin@redhat.com> 2.12a-8Phil Knirsch <pknirsch@redhat.com> 2.12a-7Elliot Lee <sopwith@redhat.com> 2.12@8879ootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootttyrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootutil-linux-2.13-0.59.el5_8.src.rpmconfig(util-linux)losetupmountschedutilsutil-linux@	@@@@@@@@@@@@@@@@@@@@@@@@@@@@JJJ@/bin/sh/bin/sh/etc/pam.d/system-auth/sbin/install-info/sbin/install-infoaudit-libsconfig(util-linux)coreutilslibaudit.so.0libblkid.so.1libc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libcrypt.so.1libncurses.so.5libpam.so.0libpam.so.0(LIBPAM_1.0)libpam_misc.so.0libpam_misc.so.0(LIBPAM_MISC_1.0)libpopt.so.0libselinux.so.1libtermcap.so.2libutempter.so.0libutempter.so.0(UTEMPTER_1.1)libutil.so.1libutil.so.1(GLIBC_2.0)libuuid.so.1libz.so.1pamrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rpmlib(VersionedDependencies)rtld(GNU_HASH)udev1.0.62.13-0.59.el5_80.66-43.0.4-14.0-13.0.3-1kernel2.2.12-74.4.2.3P}NVN1`N1`L|`L*L`KFY`JM-J6`I,u`HH`GG`F:E`EEw=`EcvE.EE"`D,DD۬`D۬`D7`D7`DDYD`DpD`DD`DXD`DDDt`Dt`DW`DVD`D`DSCCCiC`CCCC`C`Co`Cb`C_`CX`CX`CTCFCFC`CaB=`B`ByEBvBvBmh`BS
`BLrBDB8`BA?A`A'A>AAnAm`Am`Am`Ak`AdjA[0`AYAH`AH`A4A.]`AAAA@`@q`@`@@`@@W`@``@\@Wx@Wx@S`@S`@P`@O@O@K`@?@:w@6`@-H@+`@0@@@
`?????se`?k|`?bA?bA?Y`?Y`?W?8?&`?`>>k>i>:>:>`>>>`>p`>Z>S`>L`>>`>>`>=>8N>/`>#6>#6=V`==U`==`==o=Q`=K=?#`===<`=""`=`=====P`=r<f`<`<`<`<<@<z`<4`<4`<`<|`<U<,`<*H`<
G`;Q;9;9;`;`;s`;;q`;h{;e;e;];\`;N;L`;.y;)3;
`::::`:ܼ:`::`::`::`:s:m:cr:5N`:`9?99k9w`9x9x9v$9n;9jG`9a9S9:`969
`8`88{8`8`8o`8488`8W`8`8`H776870119efb90f1a6333500401310db153ed8e5e52d3e2dd06d38cd1d5af71da9382a48cc84576a7ba21703dfc95f827aab5ca0e61d86ad7062cfddc9be6b962ea711a0eb5e5ef1cb94e0e32d8439f3adca4a8b41249b1e46a2fc9bdc5097bdd68c083c8229cb58cf4feee9a6c77a3b1692a1ce15b8be120b973f14c7a0c438e6d2d18da555b5ad11a938c17ae9eba9387954183589ecc41fd66f25f6a1f3b3edbceaefbea02c38ce87e65766a02851e76df04d9a1aec310933121b0052c21fb50d141a6dc262f3a813ae979a12cd138cb0a3ed889b0a694a8d3a5d4b37330e7a611d9b909d97427b6cc3dedcc5d54ea3c3b408b9aa07f5d6ac441aebeb18bf6abba9ac5f5d4f30e6e012069847aab9b869a6827004185d7ec98113e57eb84026a52b782899e52e9ca92303a8c317b5fe64e250cb9a4d415f1b7b9e60212f2f4602d7cae1f641fd0368fd7153298c2aab5418e94242d7973d7818e9be56927a1198a7e007d0fb43a0253fdd522e42a6404bfcaa1673b613c215679a84b391ee29fec4dd070671a9665ead4b8cf18c9daccbf091619ca89c4f13b1fb57aafaf12c7ec35e70a104d78adabd1f9c6a76e8b04fae6c5d616ee0f0befbc8982232fcf352b78b8b71bcfc04c99e0b0b6989a377155bea66d84514bb72b70856998be10920a065801da28340b0eae654b7757dd80b728873856c149921f885b1b5867ba015fbb75192b0c3bf4900219eb4e9a45b35cc199d6135fbd1403125d43c48936217a72a307c811091f0996f17db0c8807a883bf033c61fa7da14a0347e70ea8c6cbf29d046c730ebab7e315c091adfa67b6c7bfef365eb8fe57522aba51784de5d91f531eb87e67f354adf221076fb5602a8dd8ae20c944c28347e10803a69caddbe4c8725929894b94414917b7dd056605d6804eaf95fced6db0c433733067f19511a37082118fa1c92ddf8e00ce1f53278b092de94713da5f120b7752f5249075f3d41ea8f45c5807d28b4ca99034224aa025d206566de9987ade1860bd9b512668ec85deddf1858524d4c4e1bcd84f25984cb3167278f268ebba4f8154f0bbaac43abe46a05bdb2c2a0b5ad612b55d3561c4751e89eda02c8701da055d655b3554af1623148b52cf31b016109d76a8d2602a0f5e3de5933b547dcf17c99cfb02ffc68605159a74d37679c2e10849ed4f0b2f71abb23253a7c2f3996f3fc47ebcc9dd6ee9565fa1f7e90dda222c2adba8d007e8c5ac08ebde65e2e987c6553c42e76e3a3e54a9e3263eba1dc4aecd3940c7b3c654435ff930f0c7a3cd2775f1af38a856c1e2f30fdd4fac40f585cd2da0e90d0f5892f6ef3bdfa1ca0e0db00f140b9ab41e922e8c07bbc29b51ee712fa58c4f08338fa87bd36790fa60872b62aebe040210321e8f9a472e1d17570ed3675347e5719969e17b8d9edbee5a0a2da0e90d0f5892f6ef3bdfa1ca0e0db0e49815d72cd9141af75dc6d8d788726290a344afa3a1a60e05c25974ce6cbefb8eafbc0cd23494cedd9471d47e55a36b296d0c1f18c5b8c008de188693909e400d31856ce54cbfdb8c8cbe7750071fb594aac1c8b82c6de7cb149a10cdb369f92da0e90d0f5892f6ef3bdfa1ca0e0db0b3043b10ac7386520917ef8307948ccf4eba71bda0bfa6d429719b76b419379bd41d8cd98f00b204e9800998ecf8427ehwclockswapon../../bin/kill../../bin/logger../../sbin/hwclockrdevrdevrdevvipw@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrP6657zPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzDmDrU7d7d7d<Q7d;mj0707dC# 7d7d>0V>0V>0V>0V7dPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzPzf6cfcd1669c9c29827a6d3b19ca0b6f3b668f909b8365d476f11814b35086eb9e142b14618f73ecb987510ae0217aa94cd7127b40b476dbb8b0488fbb8364ff1c02b3cb7d4c937599fc055324e57132b3051448f47d39e9a2eb6f95614236fd5a7e6c679def24b520e70320007a89b663297dc546dcd2f90bed79f090520018c3a9de357922031bf7b688ab6ed7f49203dea8f3266c3f3dcee169128eff97a8a20697b6a640ccd785cb8c96ac8c1ff7c20697b6a640ccd785cb8c96ac8c1ff7c01d04718ae6a4eba18b971dc710375df237e2a8bf028a54792b72dac5f61347494ec8cc3957d70da33a2f1008da93be20671453b77b6267b24ff2b0746352efedc65b482a77e7d46776d876ae381de20d12dcc56f2dfde2f47d8a39ff7ce93d0a444f63a478883b39546ee1162000ec00c8482b27a9cd2789e3691e5ca693bdcd6201a928039fc12741d8804995aab79c15b82641e1128d657fa0f5a7033b3810244b2a3efb97cc2cca6be1e9349d867cef26debc79b5fccf6003149a7c6fbe5c5fecd6188c0230950c4fab56b41eedc66d7db8070dd594c305ef7936f28912c7c1c370afad04f2ea02f2d1a2f2b2b43bf301dcda58a8924c0dfb6d339ea09bff84d2e007fb0b317ba763b26c5278f0ac0efaf133c0710292ac39426604f4776a6c736b77ee7ecf3434c46ea78c38968f20949554af6def548b66f942a28aab64ca5aed1d0784a04a1ec14175464250038593746bda71fc150e4e002e2693df100f1c919fb145df47876b0c8af9cab108e2e8ec16a147ab7ca400df061f83b94e735ea0a0802f1551e42538b52c6b82a0ddc5f9a432b33587bc113564033422d32faf7862affa058a7dd24c547f5b0fa2e4a05cbb596571b8550bf3ded02e32742f40c0b92d055054b341ca5a6e8fadf65bf545f4cd272e8411a8ff7f788fea9e9302a03a4bda03e66755d08031b0f807e8b135faa921cd1c3bccc0d4ac5682918ef7cf5bb83442888654ffde26e22fd444e6ce0e6bf4616c09ad3a81c442723a8d2821fe7d275acfc85d1655c80a0d2c6c492053b244f32fd25bf5bd8c06bc09efb4e3f5b38e7df574e08badbc7b07a2cfd9ddbc10f110be0b82c2d6a0b0de7a6a560e056fd6373e6090ceece13d4693d5a82b5145b56bfa256606fec9b79180002fd12ead1305353c749f7f9723625c0f4a26a1c2c6ce2ae82cd4798af998ede2f29cd2daea3af29fdd3fe008cf6ffe7ce865be901c75eb40770c520b3436ac4ed2cfe054e11b150d8e574b760663a0d1a836b5458a2313df9f3e20cdc57ac678f69be791cccc28f0d6e70340a8d820f282fbf9b9a52c2496708be71390fbcc5fe82ebb0e6348352246fa13d2ff8e298c1d4fc005f65be4e7084ea2c60a8278c9478d8e1e460f0c94b0471661f3839678b6f85eb38816584f8911222f3668b47997203f6c9cb692c08a52bf3f5644395c34d7803f18c23cdcd954fcda8c1f8b00a5d12700be280e9fc4f1c8d8698405bcc3a5bedaa0b5e65c1a4c1fa918bdea149c777fe00e1f383a4505a42f56cbff87909d030662acc676f1153c6ba787f4dbfc87489ddef1def88c3c23ca7cab895472b712ab1608f576d39161d8fa2798ffdf55a5a2f5b5390a22ce1ed9436adcda2a9f34d3765ab758ef242bd3d5d703f7680f6c2e55bb5f139a66c2e2e73f60cfc45665eb563bd5260f17ef77c870be1b2bcd647982bc2870074d96a859598af1f8a52b83c1a20cdd959302cdc97eadca86bb4c3c94e708dfec65a1903c163e28adc17ac217e8364243f006f3e292c7681527a8d5416b757840115bf316de2e37608712aee543c7a06b02f666de65a8bb657379d9b980574a88d9744b21894da31c8eb8994eddeab2717a34e30797cd6df0f6248221b312726c23221266ee177679089eb381070941e8f88822346d17bca8af88823850a71cce9517a1c9ca7a7b5adff4ecee51167406b4aad7cc41239ef87bd51f2d0c86a6ed2e1be7736c47382c5717592042a1088c9fd5bae50ad61e82c4f243b156035c9bb9b9c365b31abacd8bb4a52e0ec4ec71ca8254b7f36c69ea353cff3e3a1647ec78e6997bce913af3e235c431f849b7e9c27ad018ee2c3afa1eea64b4d05e53306e45447ef46e3071ee5dbb9de3cdd792cc5beddd68b62a9bfb68b4ffb011defda52ff87109fa484a5e7f240f4d03077f31098001592cb1301a73e90b3a123fc5e0452335b5bbbc486889ee11a3e9826afe51946fd7309a7c96ee1e9391850546b35b62416152f55414148d4d4849fbf85bebc127b153179X556M|?d
		E 8<EL	Zrx}		^


$
%(,7/023$&3&6V&666(686H9;H:lH>2?:BBFhGHtI`XDYXZ[\]^ bUdefklt uvw|xhyT{$
A
EA



pgthxCutil-linux2.130.59.el5_8A collection of basic system utilities.The util-linux package contains a large variety of low-level system
utilities that are necessary for a Linux system to function. Among
others, Util-linux contains the fdisk configuration tool and the login
program.Pzbuilder10.centos.orgH%CentOS-5CentOSdistributableSystem Environment/Baselinuxi386/sbin/install-info /usr/share/info/ipc.info* /usr/share/info/dir
# only for minimal buildroots without /var/log
[ -d /var/log ] || /bin/mkdir -p /var/log
/bin/touch /var/log/lastlog
/bin/chown root:root /var/log/lastlog
/bin/chmod 0644 /var/log/lastlog
# Fix the file context, do not use restorecon
if [ -x /usr/sbin/selinuxenabled ] && /usr/sbin/selinuxenabled; then
	SECXT=$( /usr/sbin/matchpathcon -n /var/log/lastlog 2> /dev/null )
	if [ -n "$SECXT" ]; then
		# Selinux enabled, but without policy? It's true for buildroots
		# without selinux stuff on host machine with enabled selinux.
		# We don't want to use any RPM dependence on selinux policy for
		# matchpathcon(2). SELinux policy should be optional.
		/usr/bin/chcon "$SECXT"  /var/log/lastlog >/dev/null 2>&1 || :
	fi
fiif [ "$1" = 0 ]; then
    /sbin/install-info --del /usr/share/info/ipc.info* /usr/share/info/dir
fi
exit 0P$  WwhL p[<@9(4a d|1>2
4F|1l94884  & (P'F|Mp h@ (,|Lt( #4*&i	
9Y0zx*0W	Zt /^C
E#Y9+1n|~R*U+a=mE_
LO
B#a2	\S D$#$ &	
$$큤ɁɁA큤PzPzPzPzPzPzPzPzPzPzPzPzPzPzP0H)	

	

		

									
	








	




	

!"&









	



LNlP,|pL8




\
P
,
 
dP,|`<0



|
X
L
(

				x	\	8	$	pXL4	/var/log/!/usr/share/locale/vi/LC_MESSAGES/
/usr/share/man/man5/	/usr/share/man/man8//usr/share/man/man3/(#/usr/share/man/man1/$/usr/share/locale/zh_TW/LC_MESSAGES/"$/usr/share/locale/zh_CN/LC_MESSAGES/!/usr/share/locale/uk/LC_MESSAGES/!!/usr/share/locale/tr/LC_MESSAGES/ !/usr/share/locale/sv/LC_MESSAGES/!/usr/share/locale/sr/LC_MESSAGES/!/usr/share/locale/sl/LC_MESSAGES/!/usr/share/locale/sk/LC_MESSAGES/!/usr/share/locale/ru/LC_MESSAGES/!/usr/share/locale/ro/LC_MESSAGES/$/usr/share/locale/pt_BR/LC_MESSAGES/!/usr/share/locale/pl/LC_MESSAGES/!/usr/share/locale/nl/LC_MESSAGES/!/usr/share/locale/ko/LC_MESSAGES/!/usr/share/locale/ja/LC_MESSAGES/!/usr/share/locale/it/LC_MESSAGES/!/usr/share/locale/id/LC_MESSAGES/!/usr/share/locale/hu/LC_MESSAGES/!/usr/share/locale/hr/LC_MESSAGES/!/usr/share/locale/he/LC_MESSAGES/!/usr/share/locale/gl/LC_MESSAGES/!/usr/share/locale/ga/LC_MESSAGES/!/usr/share/locale/fr/LC_MESSAGES/
!/usr/share/locale/fi/LC_MESSAGES/
!/usr/share/locale/et/LC_MESSAGES/
!/usr/share/locale/es/LC_MESSAGES/
!/usr/share/locale/eo/LC_MESSAGES/	!/usr/share/locale/el/LC_MESSAGES/!/usr/share/locale/de/LC_MESSAGES/!/usr/share/locale/da/LC_MESSAGES/

!/usr/share/locale/cs/LC_MESSAGES/		!/usr/share/locale/ca/LC_MESSAGES/!/usr/share/locale/af/LC_MESSAGES/LZH<$xl`4$|L@(






4


H<dX|H<




t
D
8

						t	T	H	 		/usr/share/doc/util-linux-2.13//sbin//etc/udev/rules.d//etc/pam.d/
/usr/share/doc/libpng-1.2.10//usr/share/info/
/usr/share/gettext/projects/TP/ /usr/share/gettext/projects/KDE/"/usr/share/gettext/projects/GNOME/
/usr/share/gettext/projects/	/usr/share/gettext//usr/share/doc/sed-4.1.5/'/usr/share/doc/python-urlgrabber-3.1.0/0/usr/share/doc/python-elementtree-1.2.6/samples/-/usr/share/doc/python-elementtree-1.2.6/docs/(/usr/share/doc/python-elementtree-1.2.6//usr/share/doc/openssh-4.3p2//usr/share/doc/lynx-2.8.5/test/"/usr/share/doc/lynx-2.8.5/samples///usr/share/doc/lynx-2.8.5/lynx_help/keystrokes/$/usr/share/doc/lynx-2.8.5/lynx_help//usr/share/doc/lynx-2.8.5/docs//usr/share/doc/lynx-2.8.5/ /usr/share/doc/libfontenc-1.0.2/7/usr/share/doc/gettext-devel-0.17/javadoc2/gnu/gettext///usr/share/doc/gettext-devel-0.17/javadoc2/gnu/+/usr/share/doc/gettext-devel-0.17/javadoc2/"/usr/share/doc/gettext-devel-0.17/H
/usr/share/doc//usr/share/aclocal/	
/usr/sbin//usr/libexec/openssh/
/usr/libexec//usr/lib/yum-plugins/,/usr/lib/python2.4/site-packages/urlgrabber/-/usr/lib/python2.4/site-packages/elementtree/!/usr/lib/python2.4/site-packages/
	/usr/lib/
/usr/include/(	/usr/bin/
/lib//etc/yum/pluginconf.d/	/etc/ssh/
/etc//bin/|r
&,O*9sэh^kernel
qt}pa
a&,O*9sэh^&,O*9s,/var/lib/rpmrebuilddb.5717/Conflictname
\0m ȱ

F443oxsCPPR.=Mh?OPGV(t
ډ7u1Mpz~Xp̅6a86f2020f41b1d148aa2fc89ba2a6ec22764a08O(O(53324 and glibc changes- rebuilt- Rebuild with gcc4- Update to 1.2.8- Update to 1.2.7- Update to 1.2.6
- Combine patches- Build for FC3- Include LICENSE.- Build for FC2- Replace the patches for individual security problems with the
  cumulative patch issued by the png developers. 
- Build for FC1- rebuilt- Rebuild for FC2- Rebuild for FC1- Reinstate and improve the transfix patch which got lost sometime ago, 
  but is still needed for CAN-2002-1363 (#125934)- add patch to link libm automatically
- get rid of rpath- 1.2.5- Redo the out-of-bounds fix in a slightly better way.- Bump release number to disambiguate n-v-rs.- fix a possible out-of-bounds read in the error message 
  handler. #121229- rebuilt- rebuild with changed bits/setjmp.h on ppc- rebuilt- rebuilt- add explicit epoch's where needed.- change pkg-config to use libdir instead of hardcoding /usr/lib- rebuilt- add Provides: libpng.so.3, #67007- change requires to include the Epoch- Bump & rebuild- rebuilt- Bump & rebuild- merge changes in from -6hammer- automated rebuild- automated rebuild- Don't own {_libdir}/pkgconfig
- Don't strip library, that's up to rpm- Forgot png.h- Fix compatibility with everyone else.- 1.2.2 plus makefile patches tarball
- update file list to contain versioned libpng only- automated rebuild- 1.2.1- 1.2.0- s/Copyright/License/
- fix weird versioning system (epoch was set to "2" in the main
  package, serial to "1" in the devel package. Huh?)- update to 1.0.12
- add missing libpng symlink- libpng-devel requires zlib-devel (since png.h includes zlib.h)
  (#38883)- 1.0.11- 1.0.10- 1.0.9, fixes Mozilla problems- Rebuild to get rid of 0777 dirs- Remove the workaround for Bug #20018 (from Oct 30).
  Qt 2.2.2 fixes the problem the workaround addressed.- Work around a problem causing konqueror to segfault in image preview
  mode (Bug #20018)
- Copy SuSE 7.0's patch to handle bad chunks- only include the man5 man-pages once in the main rpm- upgrade to 1.0.8 - fixes small memory leak, other bugs- automatic rebuild- patchlevel c
- FHSify- update to 1.0.6- change serial to Epoch to get dependencies working correctly- move buildroot and add URL- strip library
- rebuild to compress man pages- 1.0.5
- some tweaks to spec file to make updating easier
- handle RPM_OPT_FLAGS- changed requires in libpng-devel to include serial
- corrected typo- auto rebuild in the new build environment (release 2)- rev to 1.0.3- build for 6.0- we are Serial: 1 now because we are reverting the 1.0.2 version from 5.2
  beta to this prior one
- install man pages; set defattr defaults- translations modified for de, fr, tr- devel subpackage moved to Development/Libraries- upgraded to 1.0.1
- added buildroot- updated to new version
- spec file cleanups- built against glibc/sbin/ldconfig/sbin/ldconfigbuilder10.centos.org 1335358576 QVWTUSR(2:1.2.10-17.el5_8libpng.so.3libpng.so.3.10.0libpng12.so.0libpng12.so.0.10.0libpng-1.2.10CHANGESLICENSEREADMETODOexample.clibpng.txtpng.5.gz/usr/lib//usr/share/doc//usr/share/doc/libpng-1.2.10//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII C program textASCII English textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `libpng.so.3.10.0'symbolic link to `libpng12.so.0.10.0'
R	PRRRRRRRRRR
PPRRRRRRRRR?Â=/]+]7?OPGV('l =.)Kd$2213 <mclasen@redhat.com>  - 2:1.2.10-1Jesse Keating <jkeating@redhat.com> - 2:1.2.8-2.2.1Jesse Keating <jkeating@redhat.com> - 2:1.2.8-2.2Jesse Keating <jkeating@redhat.com>Matthias Clasen <mclasen@redhat.com> - 2:1.2.8-2Matthias Clasen <mclasen@redhat.com> - 2:1.2.8-1Matthias Clasen <mclasen@redhat.com> - 2:1.2.7-1Matthias Clasen <mclasen@redhat.com> - 2:1.2.6-1Matthias Clasen <mclasen@redhat.com> 2:1.2.5-9Matthias Clasen <mclasen@redhat.com> Matthias Clasen <mclasen@redhat.com> 2:1.2.5-8Matthias Clasen <mclasen@redhat.com> 2:1.2.5-7Elliot Lee <sopwith@redhat.com>Matthias Clasen <mclasen@redhat.com> - 2:1.2.5-5Matthias Clasen <mclasen@redhat.com> - 2:1.2.5-4Matthias Clasen <mclasen@redhat.com> - 2:1.2.5-3Than Ngo <than@redhat.com> 2:1.2.5-2Matthias Clasen <mclasen@redhat.com> 2:1.2.5-1Matthias Clasen <mclasen@redhat.com> 2:1.2.2-22Matthias Clasen <mclasen@redhat.com>Matthias Clasen <mclasen@redhat.com> Elliot Lee <sopwith@redhat.com>Mark McLoughlin <markmc@redhat.com> 2:1.2.2-19Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Jeff Johnson <jbj@redhat.com>Jonathan Blandford <jrb@redhat.com> 2:1.2.2-15Elliot Lee <sopwith@redhat.com>Jonathan Blandford <jrb@redhat.com> 2:1.2.2-12Jonathan Blandford <jrb@redhat.com>Karsten Hopp <karsten@redhat.de> 2:1.2.2-11Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2:1.2.2-9Tim Powers <timp@redhat.com> 2:1.2.2-7Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 1.2.2-4Bernhard Rosenkraenzer <bero@redhat.com> 1.2.2-3Bernhard Rosenkraenzer <bero@redhat.com> 1.2.2-2Havoc Pennington <hp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 1.2.1-1Bernhard Rosenkraenzer <bero@redhat.com> 1.2.0-1Trond Eivind Glomsrd <teg@redhat.com>Than Ngo <than@redhat.com> 1.0.12-1Bernhard Rosenkraenzer <bero@redhat.com> 1.0.11-2Bernhard Rosenkraenzer <bero@redhat.com> 1.0.11-1Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Preston Brown <pbrown@redhat.com>Prospector <bugzilla@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkrnzer <bero@redhat.com>Bernhard Rosenkrnzer <bero@redhat.com>Matt Wilson <msw@redhat.com>Cristian Gafton <gafton@redhat.com> Michael Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>- Fix CVE-2011-3048
Resolves: CVE-2011-3048- Fix CVE-2011-3045
Resolves: CVE-2011-3045- Fix CVE-2011-3026
Resolves: CVE-2011-3026- Install the correct fix for CVE-2011-2690
Resolves: #721304- Back-port fixes for CVE-2011-2690, CVE-2011-2692
  Note: CVE-2011-2691, announced at the same time, does not apply to 1.2.10;
  likewise for CVE-2011-2501
Resolves: #721304- Back-port fixes for CVE-2009-2042, CVE-2010-0205, CVE-2010-1205,
  CVE-2010-2249
Resolves: #609922- Back-port fixes for CVE-2008-1382 and CVE-2009-0040.
Resolves: #487169- Back-port critical fixes from libpng 1.2.22, primarily to fix CVE-2007-5269
Resolves: #337531
- Update License tag and some other obsolete bits in specfile- Add patch to fix CVE-2006-5793
Related: #215405- Add patch to fix CVE-2007-2445
Resolves: #239542- Require pkgconfig in the -devel subpackage as it gets called by
  /usr/bin/libpng-config- Disable asm on arches other than i386  (#196580)- rebuild- Fix some paths in the -config script- fix multilib conflicts- Add a comment about the need to keep static libraries- Re-add static libraries- Update to 1.2.10
- Drop static libraries- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot112J+?*d		 	_		&EKP	

<l4x(8X9TX:`X>&1@&@F&OG&pH&I&X&Y&\']'8^'b(d(e(f(k(l(t(u)v)4w)x*(y*X{****A+%A
+f+++g+h+Clibpng1.2.1017.el5_8A library of functions for manipulating PNG image format filesThe libpng package contains a library of functions for creating and
manipulating PNG (Portable Network Graphics) image format files.  PNG
is a bit-mapped graphics format similar to the GIF format.  PNG was
created to replace the GIF format, since GIF uses a patented data
compression algorithm.

Libpng should be installed if you need to manipulate PNG format image
files.Obuilder10.centos.org.CentOS-5CentOSzlibSystem Environment/Librarieshttp://www.libpng.org/pub/png/linuxi386z QR/6udlA큤OOOOODKNDKNDKN:E
DKNDKNO69b38d798e3c5d39a5c2b1936343243ab01555f72314fe73553af57f0627b06cfb739ba2f4e1c1d113b32c9c57976e700e47e06a0e20cd016bc0a61ed8b7798d2815909ec0e3a0bf97360cb058856e588ca97e99d5459d33dd264d59ebf4f6616e16364addf418a63683c6f7bb185e76818cc8dd5558df4ad32e8b8c1ffd5c15db32155bf7a241a0a0edd39aa7992538libpng.so.3.10.0libpng12.so.0.10.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibpng-1.2.10-17.el5_8.src.rpmlibpng.so.3libpng.so.3libpng12.so.0libpng12.so.0(PNG12_0)libpng@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfiglibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libm.so.6libm.so.6(GLIBC_2.0)libpng.so.3libpng12.so.0libz.so.1rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-1qt0:2.2.24.4.2.3O9`O] `O=|`N/8NfL.a`I`G`FG`FF8E!D7`DpDv(DsDr4`Dr4`DZy`CC`C`B&7`A`AH`A"A\`A
A`A`@q`@@@@p`@@@@K@E@?@-H>k>`>Z>Z>UO>1`>0e>/`>%==<f`<N`<N`<<Ѷ<<`<j;`;Sc;1::`::s:6:`9`99`9n;9N88d8`8`88k`7`6k66y~6	o`5R.5H`5+`4C`3[`Tom Lane <tgl@redhat.com> 2:1.2.10-17Tom Lane <tgl@redhat.com> 2:1.2.10-16Tom Lane <tgl@redhat.com> 2:1.2.10-15Tom Lane <tgl@redhat.com> 2:1.2.10-14Tom Lane <tgl@redhat.com> 2:1.2.10-13Tom Lane <tgl@redhat.com> 2:1.2.10-12Tom Lane <tgl@redhat.com> 2:1.2.10-11Tom Lane <tgl@redhat.com> 2:1.2.10-10Tom Lane <tgl@redhat.com> 2:1.2.10-9Tom Lane <tgl@redhat.com> 2:1.2.10-8Jesse Keating <jkeating@redhat.com> - 2:1.2.10-7Matthias Clasen <mclasen@redhat.com> - 2:1.2.10-6Jesse Keating <jkeating@redhat.com> - 2:1.2.10-5.1Matthias Clasen  <mclasen@redhat.com> - 2:1.2.10-5Matthias Clasen  <mclasen@redhat.com> - 2:1.2.10-4Matthias Clasen <mclasen@redhat.com> - 2:1.2.10-3Matthias Clasen <mclasen@redhat.com> - 2:1.2.10-2Matthias Clasen 900/<es: rhbz#454883
- Related: rhbz#458131- Import upstream 1.1.15 beta.
- What will be in Fedora 9 soon.
- Resolves: rhbz#454883- Fix yumdownloader --source
- Resolves: rhbz#391791- Backport man pages
- Resolves: rhbz#438169- Backport man page bug fix.
- Resolves: rhbz#437127- Rename yum groups <=> rpm groups
- Add yum groups, what was actually wanted.
- Fixup minor doc problems
- Resolves: rhbz#319491- Add man pages for list-data and filter-data
- Couple of minor tweaks.
- Resolves: rhbz#319491- Fixup repodiff
- Add docs.
- Add list-data and filter-data
- Resolves: rhbz#319491- Import into RHEL-5
- Related: rhbz#384691- Re-integrate older security info printing.
- kabi patch for ClusterStorage, as it uses the new kABI
- Upload new tarball.
- Resolves: rhbz#251542- Go back in time to upstream 1.0.4, which works with yum-3.0.1
- Resolves: rhbz#251542- Fix yum-security to do "list updates" with newer yum
- Resolves: rhbz#234646- Add resquires for updatesd to refresh-updatesd
- Remove a few of the plugins.
- Rename fedorakmod to kmod
- Resolves: rhbz#234646- Rebuild for RHEL 5
- Resolves: rhbz#234646- mark as 1.1.5- mark as 1.1.4- mark as 1.1.3- added debuginfo-install- Added security plugin written by James Antill <james@and.org>- mark as 1.1.2
- Added merge-conf plugin written by Aurelien Bompard <abompard@fedoraproject.org>- mark it as 1.1.1- mark it as 1.1.0 (again)- removed versionlock.list installation.- Added versionlock.list installation.
- fixed skip-broken description (--ignore-broken -> --skip-broken)- Add yum-refresh-updatesd plugin- Added man dirs to yum-changelog files section- mark it as 1.1.0
- Requires: yum >= 3.1.1 for yum-utils.- Added %{?dist} tag- mark it as 1.0.2- mark it as 1.0.1- Added priorities plugin written by Daniel de Kok <danieldk at pobox.com>- mark it as 1.0
- change requires for the packages to yum 3.0- added skip-broken plugin- added allowdowngrade plugin- fix the plugins/ doc issue- bump version number
- added yum-downloadonly plugin
- fix minor item in tsflags description- add reposync- added yum-fedorakmod plugin subpackage
- added yum-protectbase plugin subpackage.
- added yum-versionlock plugin subpackage.
- added yum-tsflags plugin subpackage.
- added yum-kernel-module plugin subpackage
- changed .py to .* in files sections for plugin subpackages to build rpms without error.-  changed some of the yum version dependencies- added repotrack to utils
- bumped version for 2.5.X-compatible release- bump version to 0.4
- add yum-fastestmirror subpackage- add repoquery man page- version 0.3.1
- various enhancements and fixes to repoquery
- avoid tracebacks in yumex and pup when changelog plugin is enabled- bump version to 0.3
- add yum-changelog subpackage
- add plugins as documentation to the main package
- require yum >= 2.3.4 (for getCacheDir)- Added missing GPL COPYING file- 0.2- add yum-updateboot subpackage- first version based on the mock spec filebuilder10.centos.org 1329958352LR1.1.16-21.el5.centos1.1.16-21.el5.centosfastestmirror.conffastestmirror.pyfastestmirror.pycfastestmirror.pyo/etc/yum/pluginconf.d//usr/lib/yum-plugins/-O2cpiogzip9noarchnoarch-redhat-linux-gnuASCII texta /usr/bin/python script text executabledirectory?pPqN'dodf?OFGV(stvcy9"4R#oT{UH/#BmG]5I?OFGV(yl'%9@fbDs璐ԠYa9d11387aa04a27b2c224a751cc2be2ed04f6a1bOX|eOX{8//.0 Lauridsen <tla@rasmil.dk>James Bowes <jbowes@redhat.com>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Seth Vidal <skvidal at linux.duke.edu>Tim Lauridsen <tla@rasmil.dk>Panu Matilainen <pmatilai@laiskianen.org>Seth Vidal <skvidal at linux.duke.edu>Seth Vidal <skvidal at linux.duke.edu>Seth Vidal <skvidal at linux.duke.edu>Tim Lauridsen <tla@rasmil.dk>Seth Vidal <skvidal at linux.duke.edu>Seth Vidal <skvidal@linux.duke.edu>Brian Long <brilong@cisco.com>Panu Matilainen <pmatilai@laiskiainen.org>Panu Matilainen <pmatilai@laiskiainen.org>Panu Matilainen <pmatilai@laiskiainen.org>Gijs Hollestelle <gijs@gewis.nl>Seth Vidal <skvidal@phy.duke.edu>Panu Matilainen <pmatilai@laiskiainen.org>Gijs Hollestelle <gijs@gewis.nl>- retain all plugins, not just rhn ones- fixed a bug in BZ-496580-package-cleanup-oldkernels-kernel-PAE.patch- package-cleanup oldkernels now keeps N of each kernel
- Resolves: rhbz#496580- Add reposync usage to --help.
- Resolves: rhbz#732596
- Refix for backport for repomanage.
- Resolves: rhbz#703372
- package-cleanup oldkernels kernel-xen (and anything that provides).
- Resolves: rhbz#496580- Add debuginfo install man page.
- Resolves: rhbz#530150- kmod plugin fix for install dups.
- Resolves: rhbz#543649
- Better usage for reposync arch.
- Resolves: rhbz#732596
- yumdownloader fix for dup. downloads.
- Resolves: rhbz#711768
- repomanage fix for traceback missing dir.
- Resolves: rhbz#703372
- package-cleanup count+cleandupes man page.
- Resolves: rhbz#631843
- Add debuginfo install man page.
- Resolves: rhbz#530150
- package-cleanup oldkernels kernel-PAE.
- Resolves: rhbz#496580- Fix repoquery tracebacks on non-ascii output
- Resolves: rhbz#702282- repodiff uses stale metadata cache in subsequent runs
- Resolves: rhbz#665919
- repodiff can't handle non-ascii characters in package summar
- Resolves: rhbz#647521
- repodiff is slower in RHEL5 then Fedora13
- Resolves: rhbz#646571
- [RFE] global excludes can not be overridden in repodiff
- Resolves: rhbz#643137
- yum-groups-manager breaks on gziped comps.xmls
- Resolves: rhbz#648623
- [RFE] Add yum-priorities support to RHEL / RHN
- Resolves: rhbz#518129
- yum-complete-transaction offers to erase whole system
- Resolves: rhbz#495911
- Fix instances of #!/usr/bin/env python in yum-fastestmirror
- Resolves: rhbz#521905- Add checks in yum-complete-transaction so it'll never try and delete
- the entire system.
- Resolves: rhbz#495911- Fix the yum-changelog exit, when you pass it dates and ther is no datetime
- Resolves: rhbz#472389- Fix the yum-complete-transaction cleanup bug.
- Resolves: rhbz#470776- Add the timestamp_check option, so we can have repoids to random stuff
- Resolves: rhbz#466176
- Resolves: rhbz#454883- Have repoquery set metadata_expire to 0 for manual repos.
- Resolves: rhbz#466176
- Fix list-groups help output
- Resolves: rhbz#467191
- Fix yum-groups-manager i18n bugs
- Resolves: rhbz#466176
- Resolves: rhbz#454883- Fix repodiff when comparing against older repos. than ones you'd compared
- against before.
- Resolves: rhbz#444948
- Resolves: rhbz#454883- Fix downloadonly not showing errors
- Resolves: rhbz#462797
- Resolves: rhbz#454883- Add repoid to keys info output.
- Do dynamic columns in keys output.
- Fix --bz option in yum-security
- Resolves: rhbz#462374
- Resolves: rhbz#454883- Fix the numbers in the security plugin, to be close to listTransaction
- Resolves: rhbz#454883- Import upstream 1.1.16.
- Add group management application, networkmanger script. Bug fixes.
- Remove skip-broken/basearchonly plugins, as we never shipped them and
- core yum does their jobs now.
- Remove hard dep. on dateutil, as it's only in EPEL.
- Fix typo in filter-data plugin.
- Fix typo in reposync.
- Resolves: rhbz#454883
- Resolves: rhbz#449989
- Resolves: rhbz#450873- Import next upstream 1.1.15 beta.
- gpgcheck/repo_gpgcheck change.
- include fastestmirror
- Resolv7../C)?(d	)	g	IOXh	p
x
 4Hp(<8DB9LB:BF':G'\H'lI'|X'Y'\']'^(b(9d(=e(Bf(Gk(Il(Pt(hu(xv(w(x({(())A)QA
))))g)h)Cyum-fastestmirror1.1.1621.el5.centosYum plugin which chooses fastest repository from a mirrorlistThis plugin sorts each repository's mirrorlist by connection speed
prior to downloading packages.OEbuilder10.centos.orgCentOS-5CentOSGPLv2+System Environment/Basehttp://linux.duke.edu/yum/download/yum-utils/linuxnoarchA<<ˁOEOEOEOE57cc15e34116cdb17748980a6a408442e24a6b99df7f5ff9c6684353b228fda4c8e7918ee1c3fa0128bf40f5d08a0069c8e7918ee1c3fa0128bf40f5d08a0069rootrootrootrootrootrootrootrootyum-utils-1.1.16-21.el5.centos.src.rpmconfig(yum-fastestmirror)yum-fastestmirrorJJconfig(yum-fastestmirror)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)yum1.1.16-21.el5.centos3.0.4-14.0-13.04.4.2.3OEe`Oc`OnN`NN%M`MyK`I,u`I`IH
H[`H H,`Hq`H`HH`G`G^GR`G`GG9`G!`F`F<Fv`F`F`Fw`F7`F7`F7`F)7FEEEEӆ`E4E˝`EKE`E2EG`EB`E$.E`D`DߠD]`DSDR`C0`CC.`CTC,B`BB/BR`BJohnny Hughes <johnny@centos.org> -  1.1.16-21.el5.centosZdenek Pavlas <zpavlas@redhat.com> - 1.1.16-21James Antill <james.antill@redhat.com> - 1.1.16-20James Antill <james.antill@redhat.com> - 1.1.16-19James Antill <james.antill@redhat.com> - 1.1.16-18James Antill <james.antill@redhat.com> - 1.1.16-17James Antill <james.antill@redhat.com> - 1.1.16-16James Antill <james.antill@redhat.com> - 1.1.16-15James Antill <james.antill@redhat.com> - 1.1.16-14James Antill <james.antill@redhat.com> - 1.1.16-13James Antill <james.antill@redhat.com> - 1.1.16-11James Antill <james.antill@redhat.com> - 1.1.16-10James Antill <james.antill@redhat.com> - 1.1.16-9James Antill <james.antill@redhat.com> - 1.1.16-8James Antill <james.antill@redhat.com> - 1.1.16-7James Antill <james.antill@redhat.com> - 1.1.16-6James Antill <james.antill@redhat.com> - 1.1.16-5James Antill <james.antill@redhat.com> - 1.1.16-4James Antill <james.antill@redhat.com> - 1.1.14-0_beta_15_2James Antill <james.antill@redhat.com> - 1.1.14-0_beta_15_1James Antill <james.antill@redhat.com> - 1.1.10-9James Antill <james.antill@redhat.com> - 1.1.10-8James Antill <james.antill@redhat.com> - 1.1.10-7James Antill <james.antill@redhat.com> - 1.1.10-6James Antill <james.antill@redhat.com> - 1.1.10-4James Antill <james.antill@redhat.com> - 1.1.10-3James Antill <james.antill@redhat.com> - 1.1.10-2James Antill <jantill@redhat.com> - 1.0.4-3James Antill <jantill@redhat.com> - 1.0.4-1James Antill <jantill@redhat.com> - 1.1.5-3James Antill <jantill@redhat.com> - 1.1.5-2Dennis Gregorovic <dgregor@redhat.com> - 1.1.5Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Seth Vidal <skvidal at linux.duke.edu>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Tim Lauridsen <tla@rasmil.dk>Timt8H)	

	

		

									
	








	




	

!"&U@8--,ASCII C++ program textASCII English textASCII text, with very long linesELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysetuid ELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippedtroff or preprocessor input textRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRR!R"R&RRRRRR	R
RRR
RRRRRRRRRRRR!R"R&?`|ZG[QD*?OE8GV(ug%$8<ruxU0&%K#70:f,Z@ψ?OE8GV(k;1;bT,up!n~C!}\qe84b445050563779d41510b4a1ab71bee97e11e59da1OX|1thOX{T@,,+-ile from the latest snapshot to the main package (#20884).
- Add the dev package to the prereq list (#19984).
- Remove the default path and mimic login's behavior in the server itself.- Resync with conditional options in Damien Miller's .spec file for an errata.
- Change libexecdir from %{_libexecdir}/ssh to %{_libexecdir}/openssh.- Update to OpenSSH 2.3.0p1.
- Update to x11-askpass 1.1.0.
- Enable keyboard-interactive authentication.- Update to ssh-askpass-x11 1.0.3.
- Change authentication related messages to be private (#19966).- Patch ssh-keygen to be able to list signatures for DSA public key files
  it generates.- Add BuildPreReq on /usr/include/security/pam_appl.h to be sure we always
  build PAM authentication in.
- Try setting SSH_ASKPASS if gnome-ssh-askpass is installed.
- Clean out no-longer-used patches.
- Patch ssh-add to try to add both identity and id_dsa, and to error only
  when neither exists.- Update x11-askpass to 1.0.2. (#17835)
- Add BuildPreReqs for /bin/login and /usr/bin/rsh so that configure will
  always find them in the right place. (#17909)
- Set the default path to be the same as the one supplied by /bin/login, but
  add /usr/X11R6/bin. (#17909)
- Try to handle obsoletion of ssh-server more cleanly.  Package names
  are different, but init script name isn't. (#17865)- Update to 2.2.0p1. (#17835)
- Tweak the init script to allow proper restarting. (#18023)- Update to 20000823 snapshot.
- Change subpackage requirements from %{version} to %{version}-%{release}
- Back out the pipe patch.- Update to 2.1.1p4, which includes fixes for config file parsing problems.
- Move the init script back.
- Add Damien's quick fix for wackiness.- Update to 2.1.1p3, which includes fixes for X11 forwarding and strtok().- Move condrestart to server postun.
- Move key generation to init script.
- Actually use the right patch for moving the key generation to the init script.
- Clean up the init script a bit.- Fix X11 forwarding, from mail post by Chan Shih-Ping Richard.- Update to 2.1.1p2.
- Use of strtok() considered harmful.- Get the build root out of the man pages.- Add and use condrestart support in the init script.
- Add newer initscripts as a prereq.- Build in new environment (release 2)
- Move -clients subpackage to Applications/Internet group- Update to 2.2.1p1- Patch to build with neither RSA nor RSAref.
- Miscellaneous FHS-compliance tweaks.
- Fix for possibly-compressed man pages.- Updated for new location
- Updated for new gnome-ssh-askpass build- Added Jim Knoble's <jmknoble@pobox.com> askpass- Split subpackages further based on patch from jim knoble <jmknoble@pobox.com>- Added 'Obsoletes' directives- Use make install
- Subpackages- Added links for slogin
- Fixed perms on manpages- Renamed init script- Back to old binary names- Use autoconf
- New binary names- Initial RPMification, based on Jan "Yenya" Kasprzak's <kas@fi.muni.cz> spec.builder10.centos.org 1329926563%
&()4.3p2-82.el54.3p2-82.el5sshmodulissh-keygenopensshssh-keysignopenssh-4.3p2CREDITSChangeLogINSTALLLICENCEOVERVIEWREADMEREADME.dnsREADME.nssREADME.platformREADME.privsepREADME.smartcardREADME.tunRFC.nroffTODOWARNING.RNGssh-keygen.1.gzssh-keysign.8.gz/etc//etc/ssh//usr/bin//usr/libexec//usr/libexec/openssh//usr/share/doc//usr/share/doc/openssh-4.3p2//usr/share/man/man1//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuS&H++*,ts 5.00 on 6.2 (reported by Peter Bieringer)- remove explicit openssl requirement, fixes builddistro issue
- make initscript stop() function wait until sshd really dead to avoid 
  races in condrestart- mention that challengereponse supports PAM, so disabling password doesn't
  limit users to pubkey and rsa auth (#34378)
- bypass the daemon() function in the init script and call initlog directly,
  because daemon() won't start a daemon it detects is already running (like
  open connections)
- require the version of openssl we had when we were built- make do_pam_setcred() smart enough to know when to establish creds and
  when to reinitialize them
- add in a couple of other fixes from Damien for inclusion in the errata- update to 2.5.2p2
- call setcred() again after initgroups, because the "creds" could actually
  be group memberships- update to 2.5.2p1 (includes endianness fixes in the rijndael implementation)
- don't enable challenge-response by default until we find a way to not
  have too many userauth requests (we may make up to six pubkey and up to
  three password attempts as it is)
- remove build dependency on rsh to match openssh.com's packages more closely- remove dependency on openssl -- would need to be too precise- rebuild in new environment- Revert the patch to move pam_open_session.
- Init script and spec file changes from Pekka Savola. (#28750)
- Patch sftp to recognize '-o protocol' arguments. (#29540)- Chuck the closing patch.
- Add a trigger to add host keys for protocol 2 to the config file, now that
  configuration file syntax requires us to specify it with HostKey if we
  specify any other HostKey values, which we do.- Redo patch to move pam_open_session after the server setuid()s to the user.
- Rework the nopam patch to use be picked up by autoconf.- Update for 2.5.1p1.
- Add init script mods from Pekka Savola.
- Tweak the init script to match the CVS contrib script more closely.
- Redo patch to ssh-add to try to adding both identity and id_dsa to also try
  adding id_rsa.- Update for 2.5.0p1.
- Use $RPM_OPT_FLAGS instead of -O when building gnome-ssh-askpass
- Resync with parts of Damien Miller's openssh.spec from CVS, including
  update of x11 askpass to 1.2.0.
- Only require openssl (don't prereq) because we generate keys in the init
  script now.- Don't open a PAM session until we've forked and become the user (#25690).
- Apply Andrew Bartlett's patch for letting pam_authenticate() know which
  host the user is attempting a login from.
- Resync with parts of Damien Miller's openssh.spec from CVS.
- Don't expose KbdInt responses in debug messages (from CVS).
- Detect and handle errors in rsa_{public,private}_decrypt (from CVS).- i18n-tweak to initscript.- More gettextizing.
- Close all files after going into daemon mode (needs more testing).
- Extract patch from CVS to handle auth banners (in the client).
- Extract patch from CVS to handle compat weirdness.- Finish with the gettextizing.- Fix a bug in auth2-pam.c (#23877)
- Gettextize the init script.- Incorporate a switch for using PAM configs for 6.x, just in case.- Incorporate Bero's changes for a build specifically for rescue CDs.- Don't treat pam_setcred() failure as fatal unless pam_authenticate() has
  succeeded, to allow public-key authentication after a failure with "none"
  authentication.  (#21268)- Update to x11-askpass 1.1.1. (#21301)
- Don't second-guess fixpaths, which causes paths to get fixed twice. (#21290)- Merge multiple PAM text messages into subsequent prompts when possible when
  doing keyboard-interactive authentication.- Disable the built-in MD5 password support.  We're using PAM.
- Take a crack at doing keyboard-interactive authentication with PAM, and
  enable use of it in the default client configuration so that the client
  will try it when the server disallows password authentication.
- Build with debugging flags.  Build root policies strip all binaries anyway.- Use DESTDIR instead of %makeinstall.
- Remove /usr/X11R6/bin from the path-fixing patch.- Add the primes fR]P**)+ gssapi patches
- refresh to the latest version of Markus's patch to build properly with
  older versions of OpenSSL- bump and grind (through the build system)- require sharutils for building (mindrot #137)
- require db1-devel only when building for 6.x (#55105), which probably won't
  work anyway (3.1 requires OpenSSL 0.9.6 to build), but what the heck
- require pam-devel by file (not by package name) again
- add Markus's patch to compile with OpenSSL 0.9.5a (from
  http://bugzilla.mindrot.org/show_bug.cgi?id=141) and apply it if we're
  building for 6.x- update to 3.1p1- update to SNAP-20020305
- drop debug patch, fixed upstream- update to SNAP-20020220 for testing purposes (you've been warned, if there's
  anything to be warned about, gss patches won't apply, I don't mind)- add patches from Simon Wilkinson and Nicolas Williams for GSSAPI key
  exchange, authentication, and named key support- remove dependency on db1-devel, which has just been swallowed up whole
  by gnome-libs-devel- adjust build dependencies so that build6x actually works right (fix
  from Hugo van der Kooij)- update to 3.0.2p1- update to 3.0.1p1- update to current CVS (not for use in distribution)- merge some of Damien Miller <djm@mindrot.org> changes from the upstream
  3.0p1 spec file and init script- update to 3.0p1
- update to x11-ssh-askpass 1.2.4.1
- change build dependency on a file from pam-devel to the pam-devel package
- replace primes with moduli- incorporate fix from Markus Friedl's advisory for IP-based authorization bugs- Merge changes to rescue build from current sysadmin survival cd- fix scp's server's reporting of file sizes, and build with the proper
  preprocessor define to get large-file capable open(), stat(), etc.
  (sftp has been doing this correctly all along) (#51827)
- configure without --with-ipv4-default on RHL 7.x and newer (#45987,#52247)
- pull cvs patch to fix support for /etc/nologin for non-PAM logins (#47298)
- mark profile.d scriptlets as config files (#42337)
- refer to Jason Stone's mail for zsh workaround for exit-hanging quasi-bug
- change a couple of log() statements to debug() statements (#50751)
- pull cvs patch to add -t flag to sshd (#28611)
- clear fd_sets correctly (one bit per FD, not one byte per FD) (#43221)- add db1-devel as a BuildPrerequisite (noted by Hans Ecke)- pull cvs patch to fix remote port forwarding with protocol 2- pull cvs patch to add session initialization to no-pty sessions
- pull cvs patch to not cut off challengeresponse auth needlessly
- refuse to do X11 forwarding if xauth isn't there, handy if you enable
  it by default on a system that doesn't have X installed (#49263)- don't apply patches to code we don't intend to build (spotted by Matt Galgoci)- pass OPTIONS correctly to initlog (#50151)- switch to x11-ssh-askpass 1.2.2- rebuild in new environment- disable the gssapi patch- update to 2.9p2
- refresh to a new version of the gssapi patch- change Copyright: BSD to License: BSD
- add Markus Friedl's unverified patch for the cookie file deletion problem
  so that we can verify it
- drop patch to check if xauth is present (was folded into cookie patch)
- don't apply gssapi patches for the errata candidate
- clear supplemental groups list at startup- fix an error parsing the new default sshd_config
- add a fix from Markus Friedl (via openssh-unix-dev) for ssh-keygen not
  dealing with comments right- add in Simon Wilkinson's GSSAPI patch to give it some testing in-house,
  to be removed before the next beta cycle because it's a big departure
  from the upstream version- finish marking strings in the init script for translation
- modify init script to source /etc/sysconfig/sshd and pass $OPTIONS to sshd
  at startup (change merged from openssh.com init script, originally by
  Pekka Savola)
- refuse to do X11 forwarding if xauth isn't there, handy if you enable
  it by default on a system that doesn't have X installed- update to 2.9
- drop various patches that came from or went upstream or to or from CVS- only require initscripQ(X{))(*n using gtk2 for askpass, don't buildprereq gnome-libs-devel- build- disable ACSS support- Change selinux patch to use get_default_context_with_role in libselinux.- Fix patch
	* Bad debug statement.
	* Handle root/sysadm_r:kerberos- Modify Colin Walter's patch to allow specifying rule during connection- Fix TTY handling for SELinux- Update to upstream- Apply buildreq fixup patch (#125296)- Clean up patch for upstream submission.- rebuilt- Remove use of pam_selinux and patch selinux in directly.- request gssapi-with-mic by default but not delegation (flag day for anyone
  who used previous gssapi patches)
- no longer request x11 forwarding by default- Change pam file to use open and close with pam_selinux- update to 3.8.1p1
- add workaround from CVS to reintroduce passwordauth using pam- Remove CLOSEXEC on STDERR* Wed Mar 03 2004 Phil Knirsch <pknirsch@redhat.com> 3.6.1p2-33.30.1
- Built RHLE3 U2 update package.- Close file descriptors on exec- fixed pie build- Add restorecon to startup scripts- Add multiple qualified to openssh- Eliminate selinux code and use pam_selinux- rebuilt- turn off pie on ppc- fix is_selinux_enabled- Rebuild to grab shared libselinux- turn on selinux- un#ifdef out code for reporting password expiration in non-privsep
  mode (#83585)- add machinery to build with/without -fpie/-pie, default to doing so- Don't whinge about getsockopt failing (#109161)- add missing buildprereq on zlib-devel (#104558)- turn selinux off- turn selinux on- turn selinux off- turn selinux on- additional fix for apparently-never-happens double-free in buffer_free()
- extend fix for #103998 to cover SSH1- rebuild- additional buffer manipulation cleanups from Solar Designer- turn selinux off- turn selinux on- rebuild- additional buffer manipulation fixes (CAN-2003-0695)- turn selinux on- rebuild- apply patch to store the correct buffer size in allocated buffers
  (CAN-2003-0693)
- skip the initial PAM authentication attempt with an empty password if
  empty passwords are not permitted in our configuration (#103998)- turn selinux off- turn selinux on- Add BuildPreReq gtk2-devel if gtk2- rebuild- modify patch which clears the supplemental group list at startup to only
  complain if setgroups() fails if sshd has euid == 0
- handle krb5 installed in %{_prefix} or elsewhere by using krb5-config- Add SELinux patch- rebuild- rebuild- rebuild- update to 3.6.1p2- rebuilt- add patch for getsockopt() call to work on bigendian 64bit archs- move scp to the -clients subpackage, because it directly depends on ssh
  which is also in -clients (#84329)- rebuild- rebuilt- rebuild- patch PAM configuration to use relative path names for the modules, allowing
  us to not worry about which arch the modules are built for on multilib systems- update to 3.5p1, merging in filelist/perm changes from the upstream spec- merge- fix to build on multilib systems- added gssapi patches and uncommented patch here- pull patch from CVS to fix too-early free in ssh-keysign (#70009)- 3.4p1
- drop anon mmap patch- rework the close-on-exit docs
- include configuration file man pages
- make use of nologin as the privsep shell optional- update to 3.3p1
- merge in spec file changes from upstream (remove setuid from ssh, ssh-keysign)
- disable gtk2 askpass
- require pam-devel by filename rather than by package for erratum
- include patch from Solar Designer to work around anonymous mmap failures- automated rebuild- don't require autoconf any more- build gnome-ssh-askpass with gtk2- update to 3.2.3p1
- merge in spec file changes from upstream- update to 3.2.2p1- drop buildreq on db1-devel
- require pam-devel by package name
- require autoconf instead of autoconf253 again- pull patch from CVS to avoid printing error messages when some of the
  default keys aren't available when running ssh-add
- refresh to current revisions of Simon's patches- reintroduce Simon's gssapi patches
- add buildprereq for autoconf253, which is needed to regenerate configure
  after applying theP`j((')opped old ssh obsoletes
- call the pam_session_open/close from the monitor when privsep is
  enabled so it is always called as root (patch by Darren Tucker)- improve selinux patch (by Jan Kiszka)
- upstream patch for buffer append space error (#191940)
- fixed typo in configure.ac (#198986)
- added pam_keyinit to pam configuration (#198628)
- improved error message when askpass dialog cannot grab
  keyboard input (#198332)
- buildrequires xauth instead of xorg-x11-xauth
- fixed a few rpmlint warnings- rebuild- don't request pseudoterminal allocation if stdin is not tty (#188983)- allow access if audit is not compiled in kernel (#183243)- enable the subprocess in chroot to send messages to system log
- sshd should prevent login if audit call fails- print error from scp if not remote (patch by Bjorn Augustsson #178923)- new version- bump again for double-long bug on ppc(64)- fixed another place where syslog was called in signal handler
- pass locale environment variables to server, accept them there (#179851)- new version, dropped obsolete patches- hopefully make the askpass dialog less confusing (#174765)- rebuilt- drop x11-ssh-askpass from the package
- drop old build_6x ifs from spec file
- improve gnome-ssh-askpass so it doesn't reveal number of passphrase 
  characters to person looking at the display
- less hackish fix for the __USE_GNU problem- work around missing gccmakedep by wrapping makedepend in a local script
- remove now-obsolete build dependency on "xauth"- xorg-x11-devel -> libXt-devel
- rebuild for new xauth location so X forwarding works
- buildreq audit-libs-devel
- buildreq automake for aclocal
- buildreq imake for xmkmf
-  -D_GNU_SOURCE in flags in order to get it to build
   Ugly hack to workaround openssh defining __USE_GNU which is
   not allowed and causes problems according to Ulrich Drepper
   fix this the correct way after FC5test1- rebuild against new openssl- put back the possibility to skip SELinux patch
- add patch for user login auditing by Steve Grubb- Change selinux patch to use get_default_context_with_rolelevel in libselinux.- Update selinux patch to use getseuserbyname- use include instead of pam_stack in pam config
- use fork+exec instead of system in scp - CVE-2006-0225 (#168167)
- upstream patch for displaying authentication errors- upgrade to a new upstream version- use x11-ssh-askpass if openssh-askpass-gnome is not installed (#165207)
- install ssh-copy-id from contrib (#88707)- don't deadlock on exit with multiple X forwarded channels (#152432)
- don't use X11 port which can't be bound on all IP families (#163732)- fix small regression caused by the nologin patch (#161956)
- fix race in getpeername error checking (mindrot #1054)- use only pam_nologin for nologin testing- upgrade to a new upstream version
- call pam_loginuid as a pam session module- link libselinux only to sshd (#157678)- fixed Local/RemoteForward in ssh_config.5 manpage
- fix fatal when Local/RemoteForward is used and scp run (#153258)
- don't leak user validity when using krb5 authentication- upgrade to 4.0p1
- remove obsolete groups patch- rebuilt- rebuild so that configure can detect that krb5_init_ets is gone now- don't call syslog in signal handler
- allow password authentication when copying from remote
  to remote machine (#103364)- add spaces to messages in initscript (#138508)- enable trusted forwarding by default if X11 forwarding is 
  required by user (#137685 and duplicates)
- disable protocol 1 support by default in sshd server config (#88329)
- keep the gnome-askpass dialog above others (#69131)- change permissions on pam.d/sshd to 0644 (#64697)
- patch initscript so it doesn't kill opened sessions if
  the sshd daemon isn't running anymore (#67624)- don't use initlog- fixed PIE build for all architectures- add a --enable-vendor-patchlevel option which allows a ShowPatchLevel option
  to enable display of a vendor patch level during version exchange (#120285)
- configure with --disable-strip to build useful debuginfo subpackages- wheOhY''&(mode (#674747)- improve resseding the prng from /dev/urandom or /dev/random respectively (#681291)- periodically ressed the prng from /dev/urandom or /dev/random respectively (#681291)- change cipher preferences (#661716)- change cipher preferences (#661716)
- enable to run sshd as non root user (#661669)- reenable rekeying (#659242)- add nss keys to key audit patch (#632402)- key audit patch (#632402)- supply forced command documentation (#532559)- compile in the OpenSSL engine support- record lastlog with big uid (#616396)- add OpenSSL engine support (#594815)- backport forced command directive (#532559)- stderr does not more disturb sftp (#576765)- add RAND_cleanup at the exit of each program using RAND (#557166)- revert adjustable buffer length patch (#508914)- set adjustable buffer length  (#508914)- set better buffer length in latency patch (#508914)
- close error file descriptor before running external subsystem (#530358)
- prevent initscript from hanging when generates the keys (#531738)- minimize chroot patch to be compatible with upstream (#522141)- revert latency patch to solve scp stall regression (#508914)- tiny change in chroot sftp capability into openssh-server solve ls speed problem (#440240)- workaround to plaintext recovery attack against CBC ciphers CVE-2008-5161 (#502230)- disable protocol 1 in the FIPS mode- fix scp hangup on exit (#454812)
- call integrity checks only on binaries which are part of the OpenSSH FIPS
  modules- log if FIPS mode is initialized (#492363)
- check the integrity of the binaries in the FIPS mode (#467268)- fix ssh hangup on exit (#454812)- add chroot sftp capability into openssh-server (#440240)- allow options for the sshd subsystem for the sftp logging support (#452619)- use OpenSSL RNG directly (needed for FIPS-140-2 compliance)
- when in FIPS mode do not try to use algorithms which are not allowed (#447936)
- improve transfer speed on high latency connections (#227722)
- more correct 'service sshd status' reporting (#430877)
- add logging support to the sftp server (#452619)
- small scp manual page improvement (#433381)- CVE-2007-4752 - Prevent ssh(1) from using a trusted X11 cookie if creation of an
  untrusted cookie fails (#280361)- drain acks on sftp write failures (#251565)- fixed audit log injection problem (CVE-2007-3102) (#248059)- document where the nss certificate and token dbs are looked for- experimental support for PKCS#11 tokens through libnss3 (#183423)- fix an information leak in Kerberos password authentication (CVE-2006-5052)
  (#234638)
- correctly setup context when empty level requested (#234951)- and always request default level as returned by getseuserbyname (#231695)- check requested level context against a context with the same role (#231695)- reject connection if requested mls range is not obtained (#229278)- allow selecting non-default roles and audit role changes (#227733)- support also level selection on unlabeled networks (#220487)- make sshd work with mls networking (patch by Klaus Weidner) (#220487)- fix gssapi with DNS loadbalanced clusters (#216857)- improved pam_session patch so it doesn't regress, the patch is necessary
  for the pam_session_close to be called correctly as uid 0 (#167488)- CVE-2006-5794 - properly detect failed key verify in monitor (#214642)
- kill all ssh sessions when stop is called in halt or reboot runlevel (#213008)
- remove -TERM option from killproc so we don't race on sshd restart (#213490)- improve gssapi-no-spnego patch (#208102)
- CVE-2006-4924 - prevent DoS on deattack detector (#207957)
- CVE-2006-5051 - don't call cleanups from signal handler (#208459)- don't report duplicate syslog messages, use correct local time (#189158)
- don't allow spnego as gssapi mechanism (from upstream)
- fixed memleaks found by Coverity (from upstream)
- allow ip options except source routing (#202856) (patch by HP)- drop the pam-session patch from the previous build (#201341)
- don't set IPV6_V6ONLY sock opt when listening on wildcard addr (#201594)- drNpH&&%'i <nalin@redhat.com> 3.4p1-1Nalin Dahyabhai <nalin@redhat.com> 3.3p1-2Nalin Dahyabhai <nalin@redhat.com> 3.3p1-1Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.2.3p1-3Nalin Dahyabhai <nalin@redhat.com> 3.2.3p1-2Nalin Dahyabhai <nalin@redhat.com> 3.2.3p1-1Nalin Dahyabhai <nalin@redhat.com> 3.2.2p1-1Nalin Dahyabhai <nalin@redhat.com> 3.1p1-4Nalin Dahyabhai <nalin@redhat.com> 3.1p1-3Nalin Dahyabhai <nalin@redhat.com> 3.1p1-2gssNalin Dahyabhai <nalin@redhat.com> 3.1p1-2Nalin Dahyabhai <nalin@redhat.com> 3.1p1-1Nalin Dahyabhai <nalin@redhat.com> 3.1p1-0Nalin Dahyabhai <nalin@redhat.com> SNAP-20020305Nalin Dahyabhai <nalin@redhat.com> SNAP-20020220Nalin Dahyabhai <nalin@redhat.com> 3.0.2p1-3Nalin Dahyabhai <nalin@redhat.com> 3.0.2p1-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.0.2p1-1Nalin Dahyabhai <nalin@redhat.com> 3.0.1p1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.0p1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.9p2-9Bernhard Rosenkraenzer <bero@redhat.com> 2.9p2-8Nalin Dahyabhai <nalin@redhat.com> 2.9p2-7Nalin Dahyabhai <nalin@redhat.com> 2.9p2-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrxd <teg@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Damien Miller <djm@ibs.com.au>Damien Miller <djm@mindrot.org>Damien Miller <djm@mindrot.org>Damien Miller <djm@mindrot.org>Damien Miller <djm@ibs.com.au>Damien Miller <djm@ibs.com.au>Damien Miller <djm@ibs.com.au>Damien Miller <djm@ibs.com.au>Damien Miller <djm@ibs.com.au>Damien Miller <djm@ibs.com.au>- improve RNG seeding from /dev/random (#681291,#708056)- make ssh(1)'s ConnectTimeout option apply to both the TCP connection and
  SSH banner exchange (#750725)- use IPV6_V6ONLY for sshd inet6 listening socket (#640857)- add LANGUAGE to the sent/accepted evvironment (#710229)
- ssh-copy-id copies now id_rsa.pub by default (#731930)
- repairs man pages (#731925)- set cloexec on accept socket (#642935)
- add umask to sftp (#720598)
- enable lastolg for big uids (#706315)- enable selinux domain transition to passwd_t (#689406)- enable pubkey auth in the fips Mx7%%$&com> - 4.3p1-2.1Tomas Mraz <tmraz@redhat.com> - 4.3p1-2Tomas Mraz <tmraz@redhat.com> - 4.3p1-1Tomas Mraz <tmraz@redhat.com> - 4.2p1-10Jesse Keating <jkeating@redhat.com>Tomas Mraz <tmraz@redhat.com> - 4.2p1-9Nalin Dahyabhai <nalin@redhat.com> - 4.2p1-8Warren Togami <wtogami@redhat.com> - 4.2p1-7Jeremy Katz <katzj@redhat.com> - 4.2p1-6Tomas Mraz <tmraz@redhat.com> 4.2p1-5Dan Walsh <dwalsh@redhat.com> 4.2p1-4Tomas Mraz <tmraz@redhat.com> 4.2p1-3Tomas Mraz <tmraz@redhat.com> 4.2p1-2Tomas Mraz <tmraz@redhat.com> 4.2p1-1Tomas Mraz <tmraz@redhat.com> 4.1p1-5Tomas Mraz <tmraz@redhat.com> 4.1p1-4Tomas Mraz <tmraz@redhat.com> 4.1p1-3Tomas Mraz <tmraz@redhat.com> 4.1p1-2Tomas Mraz <tmraz@redhat.com> 4.1p1-1Tomas Mraz <tmraz@redhat.com> 4.0p1-3Tomas Mraz <tmraz@redhat.com> 4.0p1-2Tomas Mraz <tmraz@redhat.com> 4.0p1-1Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.9p1-12Tomas Mraz <tmraz@redhat.com> 3.9p1-11Tomas Mraz <tmraz@redhat.com>Tomas Mraz <tmraz@redhat.com> 3.9p1-10Tomas Mraz <tmraz@redhat.com>Bill Nottingham <notting@redhat.com> 3.9p1-9Thomas Woerner <twoerner@redhat.com> 3.9p1-8.1Nalin Dahyabhai <nalin@redhat.com> 3.9p1-8Bill Nottingham <notting@redhat.com> 3.9p1-7Nalin Dahyabhai <nalin@redhat.com> 3.9p1-6Nalin Dahyabhai <nalin@redhat.com>Daniel Walsh <dwalsh@redhat.com> 3.9p1-5Daniel Walsh <dwalsh@redhat.com> 3.9p1-4Daniel Walsh <dwalsh@redhat.com> 3.9p1-3Daniel Walsh <dwalsh@redhat.com> 3.9p1-2Daniel Walsh <dwalsh@redhat.com> 3.9p1-1Alan Cox <alan@redhat.com> 3.8.1p1-5Daniel Walsh <dwalsh@redhat.com> 3.8.1p1-4Elliot Lee <sopwith@redhat.com>Daniel Walsh <dwalsh@redhat.com> 3.8.1p1-2Nalin Dahyabhai <nalin@redhat.com> 3.8.1p1-1Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-36Nalin Dahyabhai <nalin@redhat.com> 3.8.1p1-0Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-35Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-34Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-33Thomas Woerner <twoerner@redhat.com> 3.6.1p2-32Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-31Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-30Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-29Elliot Lee <sopwith@redhat.com>Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-27Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-26Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-25Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-24Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>David Woodhouse <dwmw2@redhat.com> 3.6.1p2-23Nalin Dahyabhai <nalin@redhat.com>Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-22Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-21.selDaniel Walsh <dwalsh@redhat.com> 3.6.1p2-21Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-20.selNalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-19Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-18Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-17Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-16.selBill Nottingham <notting@redhat.com> 3.6.1p2-15Bill Nottingham <notting@redhat.com> 3.6.1p2-14Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-13.selNalin Dahyabhai <nalin@redhat.com> 3.6.1p2-12Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-11Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-10Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-9.selDaniel Walsh <dwalsh@redhat.com> 3.6.1p2-8Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-7Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-6Daniel Walsh <dwalsh@redhat.com> 3.6.1p2-5Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-4Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-3Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-2Nalin Dahyabhai <nalin@redhat.com> 3.6.1p2-1Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com> 3.5p1-6Nalin Dahyabhai <nalin@redhat.com> 3.5p1-5Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 3.5p1-3Nalin Dahyabhai <nalin@redhat.com> 3.5p1-2Nalin Dahyabhai <nalin@redhat.com> 3.5p1-1Nalin Dahyabhai <nalin@redhat.com> 3.4p1-3Than Ngo <than@redhat.com> 3.4p1-2.1Curtis Zinzilieta <curtisz@redhat.com> 3.4p1-2gssNalin Dahyabhai <nalin@redhat.com> 3.4p1-2Nalin DahyabhaK&$$#%s3.so(NSS_3.9.2)libplc4.solibresolv.so.2libresolv.so.2(GLIBC_2.0)libresolv.so.2(GLIBC_2.2)libselinuxlibutil.so.1libz.so.1opensslrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)1.0.84.3p2-82.el55.201.27.70.9.8e3.0.4-14.0-14.4.2.3Oz`NNN`N`NVNE`MMm`M	:`MQ`L`LЉLЉL`LiL*lL*lL*lL)`KZKJ3JJJ`J$`JAP`Jf`J
I`I`I`IL`HD`HɔH`G,FFzFy`F`EEEEE`EU`EoT`El`ET`E!DD	`DD`DpD@`DjCC`C`CCC/`C~C`CC~NC|`Crq`Cb`CUp`CNCFC`CaBBBB`BBQBC8`B8`B#`BYB
B	6`B`A`AAaAORAGiAF`A7A7A7A4A+`A
g@q`@q`@Lj`@`@`@`@`@Wx@FU`@C`@>l`@>l`@:w@-H@@@?\?`?
`?`?? `? `?k|`?k|`?k|`?h`?h`?h`?h`?g?g?g?g?g?Y`?Y`?K`?9c`?9c`?%?>=>=>߽`>k>>Mf>H >/`>M=y==`=`=n`=Z===`==,<`<<}`<}`<)<W<<<<?<t`<j<O2`<.<<
G`;`;;`;;`;,`;;`;|B`;s;q`;o`;_A`;L`;7`;.y;`;;
`::`:`:`:`:`:u::i`:::::`::`:`:m:h:gg`:A+:-e`:%|`:$*:"`:!:`::`:{`9`9`99`9`9I`9s9l`9e`9c9_`9^i9[9Y#9Ah9988f80`8-`8(`8'G8j`88`8uPetr Lautrbach <plautrba@redhat.com> 4.3p2-82Petr Lautrbach <plautrba@redhat.com> 4.3p2-81Petr Lautrbach <plautrba@redhat.com> 4.3p2-80Jan F. Chadima <jchadima@redhat.com> - 4.3p2-79Jan F. Chadima <jchadima@redhat.com> - 4.3p2-78Jan F. Chadima <jchadima@redhat.com> - 4.3p2-77Jan F. Chadima <jchadima@redhat.com> - 4.3p2-76Jan F. Chadima <jchadima@redhat.com> - 4.3p2-75Jan F. Chadima <jchadima@redhat.com> - 4.3p2-73Jan F. Chadima <jchadima@redhat.com> - 4.3p2-72Jan F. Chadima <jchadima@redhat.com> - 4.3p2-71Jan F. Chadima <jchadima@redhat.com> - 4.3p2-70Jan F. Chadima <jchadima@redhat.com> - 4.3p2-69Jan F. Chadima <jchadima@redhat.com> - 4.3p2-68Jan F. Chadima <jchadima@redhat.com> - 4.3p2-47Tomas Mraz <tmraz@redhat.com> - 4.3p2-46Jan F. Chadima <jchadima@redhat.com> - 4.3p2-45Jan F. Chadima <jchadima@redhat.com> - 4.3p2-44Jan F. Chadima <jchadima@redhat.com> - 4.3p2-43Jan F. Chadima <jchadima@redhat.com> - 4.3p2-42Jan F. Chadima <jchadima@redhat.com> - 4.3p2-41Jan F. Chadima <jchadima@redhat.com> - 4.3p2-40Jan F. Chadima <jchadima@redhat.com> - 4.3p2-39Jan F. Chadima <jchadima@redhat.com> - 4.3p2-38Jan F. Chadima <jchadima@redhat.com> - 4.3p2-37Tomas Mraz <tmraz@redhat.com> - 4.3p2-36.1Jan F. Chadima <jchadima@redhat.com> - 4.3p2-36Jan F. Chadima <jchadima@redhat.com> - 4.3p2-35Tomas Mraz <tmraz@redhat.com> - 4.3p2-34Jan F. Chadima <jchadima@redhat.com> - 4.3p2-33Tomas Mraz <tmraz@redhat.com> - 4.3p2-32Jan F. Chadima <jchadima@redhat.com> - 4.3p2-31Jan F. Chadima <jchadima@redhat.com> - 4.3p2-30Tomas Mraz <tmraz@redhat.com> - 4.3p2-29Tomas Mraz <tmraz@redhat.com> - 4.3p2-28Dennis Gregorovic <dgregor@redhat.com> - 4.3p2-26.el5_2.1Tomas Mraz <tmraz@redhat.com> - 4.3p2-26Tomas Mraz <tmraz@redhat.com> - 4.3p2-24Tomas Mraz <tmraz@redhat.com> - 4.3p2-23Tomas Mraz <tmraz@redhat.com> - 4.3p2-22Tomas Mraz <tmraz@redhat.com> - 4.3p2-21Tomas Mraz <tmraz@redhat.com> - 4.3p2-20Tomas Mraz <tmraz@redhat.com> - 4.3p2-19Tomas Mraz <tmraz@redhat.com> - 4.3p2-18Tomas Mraz <tmraz@redhat.com> - 4.3p2-17Tomas Mraz <tmraz@redhat.com> - 4.3p2-16Tomas Mraz <tmraz@redhat.com> - 4.3p2-15Tomas Mraz <tmraz@redhat.com> - 4.3p2-14Tomas Mraz <tmraz@redhat.com> - 4.3p2-13Tomas Mraz <tmraz@redhat.com> - 4.3p2-10.1Tomas Mraz <tmraz@redhat.com> - 4.3p2-10Tomas Mraz <tmraz@redhat.com> - 4.3p2-9Tomas Mraz <tmraz@redhat.com> - 4.3p2-8Tomas Mraz <tmraz@redhat.com> - 4.3p2-7Tomas Mraz <tmraz@redhat.com> - 4.3p2-6Jesse Keating <jkeating@redhat.com> - 4.3p2-5.1Tomas Mraz <tmraz@redhat.com> - 4.3p2-5Tomas Mraz <tmraz@redhat.com> - 4.3p2-4Tomas Mraz <tmraz@redhat.com> - 4.3p2-3Tomas Mraz <tmraz@redhat.com> - 4.3p2-2Tomas Mraz <tmraz@redhat.com> - 4.3p2-1Jesse Keating <jkeating@redhat.J##$Dt?{d
		S,09@	DZ	
D7
P		$'	'q'(89:9FDGdHIX4Y<\X]^	bAdefkltuhvwx,y7{dAA
"LPhglhpCopenssh4.3p282.el5The OpenSSH implementation of SSH protocol versions 1 and 2SSH (Secure SHell) is a program for logging into and executing
commands on a remote machine. SSH is intended to replace rlogin and
rsh, and to provide secure encrypted communications between two
untrusted hosts over an insecure network. X11 connections and
arbitrary TCP/IP ports can also be forwarded over the secure channel.

OpenSSH is OpenBSD's version of the last free version of SSH, bringing
it up to date in terms of security and features, as well as removing
all patented algorithms to separate libraries.

This package includes the core files necessary for both the OpenSSH
client and server. To make this package useful, you should also
install openssh-clients, openssh-server, or both.OE5builder10.centos.orgfCentOS-5CentOSBSDApplications/Internethttp://www.openssh.com/portable.htmllinuxi386a:>V
G	p
g!
SDA큀AA큤OE3OE3OE4OE4OE4OE4CxXC),BkP7CxX@C%&?:OEClCB7?	C?	AEB*OE3OE3d93b0dd7a654a68e39361caff3f3061eef86e9d3235f24f3a06ea980bb72d2d8d8428d153b58ce04e193e78b63a953b1a9079f5af43f6a4bb11063a2cfe027d67e2f09962c5d6b14f840ad6dab1bdf643a384700ae8d0a58a94891088bea14c501edb91906ea3ee20f30c8c08b719f05e4d5f4911b5af0d0754d0ab72eb3fe739a10174e0986d418ef4fd5908e6daf6ab95152df73c12915c6515e1ebd5ebc4a4b5c378f44b007734a1a7319d5c4baeedb5d60f576f88bc4f6db06aed68fc274b60261e8c56b5a87f5f7623e0d9a0db6c44157de08cf95916a60011df9c164863b8ba8fd2068d93ea946e0ac4b022ab36f14698d798ca080eecc15245c6df593354b7e3cb519117191c64f2bbd3ff4159e14b58e13b165c77e2ba73496f1fa5e5df92db92ee76621d80ded1a70d9ba01eb7c8d7453d3d7369ee3a4ee9217f022rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootopenssh-4.3p2-82.el5.src.rpmconfig(openssh)openssh@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@JJ@/sbin/nologinaudit-libsconfig(openssh)initscriptslibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libcom_err.so.2libcrypt.so.1libcrypto.so.6libfipscheck.so.1libgssapi_krb5.so.2libk5crypto.so.3libkrb5.so.3libnsl.so.1libnss3.solibnss3.so(NSS_3.2)libnss3.so(NSS_3.3)libnss3.so(NSS_3.4)libnss3.so(NSS_3.6)libnss3.so(NSS_3.9)libns""!atch
- Add exclude filter patch
- Cleanup make files
- Add python bindings- Add initial version of audisp. Just a placeholder at this point
- Remove -t from auditctl- Add 2 more summary reports
- Add 2 more message types/sbin/ldconfig/sbin/ldconfigbuilder10.centos.org 1329923303
k

Hj1.8-2.el51.8-2.el5libaudit.conflibaudit.so.0libaudit.so.0.0.0libauparse.so.0libauparse.so.0.0.0/etc//lib/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII English textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `libaudit.so.0.0.0'symbolic link to `libauparse.so.0.0.0'
	RPRRRRR
RRRRPRRRRRR	R
RRR?@=f:VCR?OE5GV(+=u})ہ=3yicm^n9?OE5GV(Gj	p73U@1%TO544ab2ba7e9b99e402e75da9b2067e887c1873bcOX|`0OX{!! "t in some cases
- Fix option parsing to ignore malformed lines- rebuilt with latest binutils to pick up 64K -z commonpagesize on ppc*
  (#203001)- Remove debug lines from dispatcher- Change audisp to use a named pipe- Fix dispatcher to handle sigchld
- Fix library location for 64 bit
- Add Prereq- Eliminate avc package from audisp- More fixes for setroubleshoot to handle failing plugin- Fixes for setroubleshoot- Switch out dispatcher
- Fix bug upgrading rule types- rebuild- Add support for the new filter key
- Update syscall tables for 2.6.17
- Add audit failure query function
- Switch out gethostbyname call with getaddrinfo
- Add audit by obj capability for 2.6.18 kernel
- Ausearch & aureport now fail if no args to -te
- New auditd.conf option to choose blocking/non-blocking dispatcher comm
- Ausearch improved search by label- Apply patch to ensure watches only associate with exit filter
- Apply patch to correctly show new operators when new listing format is used
- Apply patch to pull kernel's audit.h into python bindings
- Collect signal sender's context- Require kernel-headers, not glibc-kernheaders. Again.- Updates for new glibc-kernheaders
- Change auditctl to collect list of rules then delete them on -D
- Update capp.rules and lspp.rules to comment out rules for the possible list
- Add new message types
- Support sigusr1 sender identity of newer kernels
- Add support for ppid in auditctl and ausearch
- fix auditctl to trim the '/' from watches
- Move audit daemon config files to /etc/audit for better SE Linux protection- Require kernel-headers, not glibc-kernheaders
- Fix redefinition of audit_rule_data with new kernel headers
- Remove abuse of __KERNEL__ in lookup_table.c- New message type for trusted apps
- Add new keywords today, yesterday, now for ausearch and aureport
- Make audit_log_user_avc_message really send to syslog on error
- Updated syscall tables in auditctl
- Deprecated the 'possible' action for syscall rules in auditctl
- Update watch code to use file syscalls instead of 'all' in auditctl- Add support for new file system auditing kernel subsystem- New message types
- Support new rule format found in 2.6.17 and later kernels
- Add support for audit by role, clearance, type, sensitivity- Changed audit_log_semanage_message to take new params
- In aureport, add class between syscall and permission in avc report
- Fix bug where fsync is called in debug mode
- Add optional support for tty in SYSCALL records for ausearch/aureport
- Reinstate legacy rule operator support
- Add man pages
- Auditd ignore most signals- bump again for double-long bug on ppc(64)- Change audit_log_semanage_message to check strlen as well as NULL.- Change audit_log_semanage_message to take new params.- Fix bug in autrace where it didn't run on kernels without file watch support
- Add syslog message to auditd saying what program was started for dispatcher
- Remove audit_send_user from public api
- Fix bug in USER_LOGIN messages where ausearch does not translate
  msg='uid=500: into acct name (#178102).
- Change comm with dispatcher to socketpair from pipe
- Change auditd to use custom daemonize to avoid race in init scripts
- Update error message when deleting a rule that doesn't exist (#176239)
- Call shutdown_dispatcher when auditd stops
- Add new logging function audit_log_semanage_message- rebuilt for new gcc4.1 snapshot and glibc changes- Add timestamp to daemon_config messages (#174865)
- Add error checking of year for aureport & ausearch
- Treat af_unix sockets as files for searching and reporting
- Update capp & lspp rules to combine syscalls for higher performance
- Adjusted the chkconfig line for auditd to start a little earlier
- Added skeleton program to docs for people to write their own dispatcher with
- Apply patch from Ulrich Drepper that optimizes resource utilization
- Change ausearch and aureport to unlocked IO- Add more message types- Add support for alpha processors
- Update the audisp code
- Add locale code in ausearch and aureport
- Add new rule operator p  !ogs
- audit by TTY support added
- New multi-threaded audit event dispatcher supporting plugins
- node/machine field can be added to audit events
- RACF zos remote logging plugin from IBM
- week-ago keyword added to aureport/ausearch
- auditctl supports errno abbreviation as syscall exit code (-F exit=-EPERM)
- audit logging can be resumed with SIGUSR2
- New aulastlog utilityresolves: #251327 swig was incorrectly incoporating a variable in ppc's
python bindings causing python tracebacks.Resolves: #251911  segfault in aureport when -if option used- Fix some bugs found in 1.5.6 version of audit
Resolves: #249759- Fix a double free when auditd receives SIGHUP
Related: #235321  audit DAEMON_CONFIG record truncated- Add Requires: audit-libs-python to the main package for /sbin/audispd- Drop system-config-audit again- Add system-config-audit
- Fix Python binding compilation on ppc
- Fix subtree auditing (Patch by Alexander Viro)- Update to latest upstream
Resolves: #200784 Add audit parsing library
Resolves: #237788 Init script updateResolves: #234923: Adjusted the lspp & capp.rules file for evaluationResolves: #234923: update lspp & capp.rules file for evaluationResolves: #235468  parse DAEMON_END records for subject
Resolves: #235321  audit DAEMON_CONFIG record truncated
Resolves: #234548  audit-libs-python does not require kernel-headers
Resolves: #232166  service auditd returns status 0 when the service is stopped- Add support for OBJ_PID record type
Related: #228384- Added NISPOM sample rules
- Fix ausearch -se option to work for obj labels (#230740)
- Fix auditd init script for /usr on netdev (#228528)
- updated audit_rule_fieldpair_data to handle perm correctly (#226780)
Resolves: #230740 #228528 #226780- Fix error messages in ausearch/aureport command options
- Add tgkill to S390* syscall tables
Resolves: #218484- Sync timestamps of libaudit.conf
Resolves: #218127- Fix parsing of exit_group syscalls
Resolves: #217952- Add new msg types
- ausearch & aureport implement uid/gid caching
- In ausearch & aureport, extract addr when hostname is unknown
- In ausearch & aureport, test audit log presence O_RDONLY
Resolves: #215257
- New ausearch/aureport time keywords: recent, this-week, this-month, this-year
- Added --add & --delete option to aureport
- Update res parsing in config change events
- Increase the size on audit daemon buffers
- Parse avc_path records in ausearch/aureport
- ausearch has new output mode, raw, for extracting events
- ausearch/aureport can now read stdin
- Rework AVC processing in ausearch/aureport
- Added long options to ausearch and aureport
Resolves: #217870- Some auditd config strings were not initialized in aureport (#211443)
- Updated man pages
- Add Netlabel event types to libaudit
- Update aureports to current audit event types
- Deprecated all the old audit_rule functions from public API
- Drop auparse library for the moment- Update to fix libaudit defines
- Patch to fix (#208834)- Add dist tag and bump version (#208532)
- Make internal auditd buffers bigger for context info
- Correct address resolving of hostname in logging functions
- Do not allow multiple msgtypes in same audit rule in auditctl (#207666)
- Only =, != operators for arch & inode fields in auditctl (#206427)
- Updated audit message type table
- Remove watches from aureport since FS_WATCH is deprecated
- Add audit_log_avc back temporarily (#208152)- Fix logging messages to use addr if passed.
- Apply patches from Tony Jones correcting no kernel support messages
- Updated syscall tables for 2.6.18 kernel
- Remove deprecated functions: audit_log, audit_log_avc, audit_log_if_enabled
- Disallow syscall auditing on exclude list
- Improve time handling in ausearch and aureport (#191394)
- Attempt to reconstruct full path from relative for searching- Rename audit event socket- Another minor update to auditctl -p option- Apply updates to dispatcher
- Fix a couple bugs regarding MLS labels
- Resurrect -p option
- Tighten rules with exclude filter
- Fix parsing issue which lead to segfaul .com> 1.2.8-1Steve Grubb <sgrubb@redhat.com> 1.2.7-2Steve Grubb <sgrubb@redhat.com> 1.2.6-3Steve Grubb <sgrubb@redhat.com> 1.2.6-2Steve Grubb <sgrubb@redhat.com> 1.2.6-1Jesse Keating <jkeating@redhat.com> - 1.2.5-8Dan Walsh <dwalsh@redhat.com> 1.2.5-7Dan Walsh <dwalsh@redhat.com> 1.2.5-6Dan Walsh <dwalsh@redhat.com> 1.2.5-5Dan Walsh <dwalsh@redhat.com> 1.2.5-4Dan Walsh <dwalsh@redhat.com> 1.2.5-3Dan Walsh <dwalsh@redhat.com> 1.2.5-2Steve Grubb <sgrubb@redhat.com> 1.2.5-1Jesse Keating <jkeating@redhat.com> - 1.2.4-1.1Steve Grubb <sgrubb@redhat.com> 1.2.4-1Steve Grubb <sgrubb@redhat.com> 1.2.3-1David Woodhouse <dwmw2@redhat.com> 1.2.2-2Steve Grubb <sgrubb@redhat.com> 1.2.2-1David Woodhouse <dwmw2@redhat.com> 1.2.1-2Steve Grubb <sgrubb@redhat.com> 1.2.1-1Steve Grubb <sgrubb@redhat.com> 1.2-1Steve Grubb <sgrubb@redhat.com> 1.1.6-1Steve Grubb <sgrubb@redhat.com> 1.1.5-1Jesse Keating <jkeating@redhat.com> - 1.1.4-5.1Steve Grubb <sgrubb@redhat.com> 1.1.4-5Steve Grubb <sgrubb@redhat.com> 1.1.4-3Steve Grubb <sgrubb@redhat.com> 1.1.4-1Jesse Keating <jkeating@redhat.com> - 1.1.3-1.1Steve Grubb <sgrubb@redhat.com> 1.1.3-1Steve Grubb <sgrubb@redhat.com> 1.1.2-1Steve Grubb <sgrubb@redhat.com> 1.1.1-1Steve Grubb <sgrubb@redhat.com> 1.1-1Steve Grubb <sgrubb@redhat.com> 1.0.12-1resolves: #667536 Allow setting syslog facility for audisp syslog plugin
resolves: #697013 audit package rebase
resolves: #706156 searching on auid = -1 results in all events
resolves: #654883 service auditd restart output in immutable mode is not clear.
resolves: #671261 auditctl and audit.rules man pages inconsistent on -a option
resolves: #702279 autrace -r fails to insert audit rules on 32 bit platformsresolves: #649952 audisp-remote leaks memoryresolves: #554553 filtering a large inode number on i386 doesn't work
resolves: #568677 aureport help and man page don't show all options
resolves: #585356 audit updates for virtualization
resolves: #607823 inodes display incorrectly when listing rulesresolves: #529851 New upstream version with many updates
resolves: #519790 Crash interpreting IPC mode fields via libauparse
resolves: #513974 aureport does not accept dates as given in the man pagesresolves: #235398 ausearch does not correctly find out of order records
resolves: #471383 Missing description of '--exact' in ausyscall man page
resolves: #474466 audispd: plugin /sbin/audisp-remote terminated unexpectedly
resolves: #476189 audispd activates the same plugin several times
resolves: #483086 fix tty audit reporting
resolves: #483608 audit updates for 5.4resolves: #487237 auditd memory leak when NOLOG option givenresolves: #476009 Unknown keyword "enable_krb5" in audisp-remote.confresolves: #468719 Need to adjust requires for system-config-auditresolves: #468668 aureport/ausearch --start recent regressionresolves: #467930 AVC denials during upgrade of audit pkgs
- Disable GSSAPI support until plugin approach is created
resolves: #446080 Fix a couple problems found in updateresolves: #446080 New upstream version with many updatesresolves: #442556 audit rules with >= get corrupted
resolves: #438844 buffer overflow in audit_log_user_command, better fixresolves: #438844 buffer overflow in audit_log_user_command
- adjust ausearch.patch to audit 1.6.5resolves: #438844 buffer overflow in audit_log_user_command
- Update ausearch with fixes from auparse, 440086resolves: #438844 buffer overflow in audit_log_user_command
- Also removed lsb headers from init scriptresolves: #435947 system-config-audit does not run
- Also revised patch for audispd memory leakresolves: #435329 memory leak in audispdresolves: #432866
- Fix leaked descriptors in audispd
- aureport does not work when run from a cron job
- ausearch -m ANOM_PROMISCUOUS did not work because of parse error
- ausearch recent keyword was searching since midnight instead of last 10 min
- man page updatesresolves: #234663, #244349
- auparse library has been updated
- system-config-audit has added
- auditd now supports group permissions on audit l.F@,??Ad
		4	 4	>
H\
2L`(;8DG9`G:G><@<F<-G<PH<dI<xX<Y<\<]<^=b=d=e=f=k=l=t=u=v>w>x>y>{?<?T?X?hA?A
?@@@ g@$h@(Caudit-libs1.82.el5Dynamic library for libauditThe audit-libs package contains the dynamic libraries needed for
applications to use the audit framework.OESbuilder10.centos.org\CentOS-5CentOSLGPLDevelopment/Librarieshttp://people.redhat.com/sgrubb/audit/linuxi386u4N`OEFOENOEGOENcdc703f9d27f0d980271a9e95d0f18b2e64f50d8c212ce355a5e9d045d2be4630f8197fa58febffccda35d086e7c4d6blibaudit.so.0.0.0libauparse.so.0.0.0rootrootrootrootrootrootrootrootrootrootaudit-1.8-2.el5.src.rpmconfig(audit-libs)libaudit.so.0libauparse.so.0audit-libs@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfigconfig(audit-libs)libaudit.so.0libauparse.so.0libc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)1.8-2.el53.0.4-14.0-14.4.2.3N%L~`LK I`I`IA`II9IH`HGG`GG`G`GG,FF`FF#FFFF`F1 F/`F`E`E`E|`EpEoT`EoT`E>E4E`ED
`Dg`D`D8`D	`D `DN`DN`D`DD`DpDDv(DjK`De`DNDB`D6D5`DCCC`CiC`CC`C Crq`Co`Steve Grubb <sgrubb@redhat.com> 1.8-2Steve Grubb <sgrubb@redhat.com> 1.7.18-2Steve Grubb <sgrubb@redhat.com> 1.7.18-1Steve Grubb <sgrubb@redhat.com> 1.7.17-3Steve Grubb <sgrubb@redhat.com> 1.7.13-2Steve Grubb <sgrubb@redhat.com> 1.7.7-7Steve Grubb <sgrubb@redhat.com> 1.7.7-6Steve Grubb <sgrubb@redhat.com> 1.7.7-5Steve Grubb <sgrubb@redhat.com> 1.7.7-4Steve Grubb <sgrubb@redhat.com> 1.7.7-3Steve Grubb <sgrubb@redhat.com> 1.7.7-2Steve Grubb <sgrubb@redhat.com> 1.6.5-9Peter Vrabec <pvrabec@redhat.com> 1.6.5-8Steve Grubb <sgrubb@redhat.com> 1.6.5-7Steve Grubb <sgrubb@redhat.com> 1.6.5-6Steve Grubb <sgrubb@redhat.com> 1.6.5-4Steve Grubb <sgrubb@redhat.com> 1.6.5-3Steve Grubb <sgrubb@redhat.com> 1.6.5-2Steve Grubb <sgrubb@redhat.com> 1.6.5-1Steve Grubb <sgrubb@redhat.com> - 1.5.5-7Steve Grubb <sgrubb@redhat.com> - 1.5.5-6Steve Grubb <sgrubb@redhat.com> - 1.5.5-5Miloslav Trmač <mitr@redhat.com> - 1.5.5-4Miloslav Trmač <mitr@redhat.com> - 1.5.5-3Miloslav Trmač <mitr@redhat.com> - 1.5.5-2Miloslav Trmač <mitr@redhat.com> - 1.5.5-1Steve Grubb <sgrubb@redhat.com> 1.5.4-1Steve Grubb <sgrubb@redhat.com> 1.3.1-6Steve Grubb <sgrubb@redhat.com> 1.3.1-5Steve Grubb <sgrubb@redhat.com> 1.3.1-4Steve Grubb <sgrubb@redhat.com> 1.3.1-3Steve Grubb <sgrubb@redhat.com> 1.3.1-2Steve Grubb <sgrubb@redhat.com> 1.3.1-1Steve Grubb <sgrubb@redhat.com> 1.3-3Steve Grubb <sgrubb@redhat.com> 1.3-2Steve Grubb <sgrubb@redhat.com> 1.3-1Steve Grubb <sgrubb@redhat.com> 1.2.9-1Steve Grubb <sgrubb@redhat.com> 1.2.8-2Steve Grubb <sgrubb@redhat- Fix serious problem where chkfontpath sends SIGUSR1 to PID 2 bug (#90999)
- Replace hard coded xfs config file paths with constants
- Implemented fatalerror() for displaying variadic error messages and bailing
  with EXIT_FAILURE when "quiet" mode is not enabled, or silencing error
  output and exiting with EXIT_SUCCESS when "quiet" mode is enabled.  Replaced
  all conditionalized tests for quiet mode throughout the code, and changed
  all critical error messages with calls to fatalerror()
- Make restartXfs() more robust, with a fallback for if /proc isn't available.- Bump and rebuild in new environment as 1.9.7-1
- Fixes for GNU extension usage isblank()- Bump and rebuild in new environment as 1.9.6-1- document missing arguments (#24055) in man page
- use popt to generate help text for the program- #ifdef out some debugging code (#24054)
- do a setlocale() before using ctype functions- fixed up handling of catalogue line in situations where there is no
  path listed on the first line (#10128)
- fixed up handling when adding a directory to empty font path (#11108)
- use fputs where more correct (#14286)- Prereq: XFree86-xfs to insure that it gets installed before
  chkfontpath is.  This should promote XFree86-xfs to be installed
  before any package that has a Prereq: on chkfontpath
- Prereq: /sbin/pidof (even though a Requires: should be sufficient)- FHS macros- rebuilt to get rid of broken deps- rebuild to gzip man page, update description.- patches from JJ understand :unscaled automatically, no longer necessary
  to specify manually on the cmd line
- tries to keep specific font groups together much harder.- incorporated patches to deal with :unscaled font dir entries, and
  add a --first flag to add the path at the beginning instead of the end.
- minor cleanups- fixed up basename
- default to list, not help
- if trailing slash '/' is appended to paths given, strip it off- preserve permissions on config file- if /proc isn't mounted, don't do a killall- don't use psmisc, use pidof from SysVinit- made psmisc a requirement.- added "quiet" option.- injected new group / description.- important fix - kill font server with USR1 instead of HUP.- initial spec filebuilder5.centos.org 1168208783]L]X1.10.1-1.1chkfontpathchkfontpath.8.gz/usr/sbin//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippeddirectoryRRRRRRRR
?8^aȅ"+5:t?FNGV(sW
<
8B:Xڌ t?应{Ɉ?FNGV(<AwZNbƍkE&/Ձm܌?eff02849d1d2902b68916754360ccd7df9262e8bNs`4Ns:pBp?d		[dh|		


(HP\h(8 9 : FiGHIXY\]^bdefkltuvwXx`yh{AA
2\`dghhlCchkfontpath1.10.11.1Simple interface for editing the font path for the X font server.This is a simple command line utility for configuring the directories
in the X font server's path.  It is mostly intended to be used
'internally' by RPM when packages with fonts are added or removed, but
it may be useful as a stand-alone utility in some instances.Esbuilder5.centos.org3&CentOSGPLSystem Environment/Baselinuxi386.X΁큤EsEsec70e99e82c741ac4a1381a9368d9b7cdace6569c8090c46392fbec53080cf6crootrootrootrootchkfontpath-1.10.1-1.1.src.rpmchkfontpath@@@@@@@JJ@/sbin/pidoflibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libpopt.so.0rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)xfs3.0.4-14.0-14.4.2DpCCC`C`B
*B
*@q`@Wx>1`>ʥ`>_`>H <`:gg`:gg`:_~`9b^`9E]`9#`8`8`778`77`7I`6`66v`6`6ȘJesse Keating <jkeating@redhat.com> - 1.10.1-1.1Mike A. Harris <mharris@redhat.com> 1.10.1-1Jesse Keating <jkeating@redhat.com> - 1.10.0-4.2.1Jesse Keating <jkeating@redhat.com> - 1.10.0-4.2Jesse Keating <jkeating@redhat.com>Mike A. Harris <mharris@redhat.com> 1.10.0-4Mike A. Harris <mharris@redhat.com> 1.10.0-3Elliot Lee <sopwith@redhat.com> 1.10.0-2Mike A. Harris <mharris@redhat.com> 1.10.0-1Mike A. Harris <mharris@redhat.com> 1.9.10-1Bill Nottingham <notting@redhat.com> 1.9.9-1Mike A. Harris <mharris@redhat.com> 1.9.8-1Mike A. Harris <mharris@redhat.com> 1.9.7-1Mike A. Harris <mharris@redhat.com> 1.9.6-1Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Matt Wilson <msw@redhat.com>Preston Brown <pbrown@redhat.com>Matt Wilson <msw@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>- rebuild- Implemented new --listfp option for bug (#153324).
- Fix stderr output redirection bug in kill invocation (#176444).
- Check return code from realloc() and exit on failure.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Rebuilt with gcc 4 for FC4- Rebuilt for FC4- rebuilt- Change PreReq: XFree86-xfs to Requires: xfs, which is a virtual Provide
  that is present in the xorg-x11 packaging, and in XFree86-4.3.0-64 and
  later builds.  This is necessary in order to make packages not require a
  specific X11 implementation unnecessarily.  (#118469)- Add patch from Uli, with some cosmetic cleanups to fix bug (#90942)- don't forcibly strip binaries on make installve\KB1 |kbQH7.









x
g
^
M
D
3
*


}tcZI@/&yp_VE<+"









u
d
S
J
9
(


										{	r	a	X	G	>	-	$		
	wn]TC:) |kbQH7.
2[AӚ%8akZb>


K\7DsJsĺ#_$nr;
צT96
OP5Z^]+c	p鞂AJ6|e<_ڧ%q'du
}~C`b:/wU
-=m["&dZutVxzÒPG
&qMc_8
684pxC{[L
+ϯA1畽}H8X<^_h/3<>k0~L. pȹO*(uWI:y_)GY&ԏ"{yg>"Oi!kpUJ .;}V<6
{VX Gp$a9~&,E{a3=N(Ndh^dI)?/!)+[0,L&&6S|h9k\P~Q)cAZFAݪ|NJ.NYkLDxER(I'9*q y	
+%?G46rE_S?fd`p~R.GH~-y_o=5m6*dL]ei[݋)P2#3i(d޿%G2ݪ&br#Wܦ"(5}r lNLP|,J>z:4טsXU;G&DFLufp'u0j&ꄹ$(f~r~BM[%+!qcyxNntJY9ϿO]s$s̘[è+_y70N!k,4}g]Ikf	T):ﯶm\w}3jlsVܣ(g=<silIJe,h,HJDGOcB7H)k8]`@bYBTz<V?`w=`KGI@iň,yF?bּeEB*GSFw	$[6(cH$5!s+2`<HRgXv4-TE9FH,TZAdp\(l'93Ɓ"?iIН$Yloi+@Q=rIw]<]0b+`Hݏ)6{G_nmchЧ=AZx3RMF(-&gLlG1pQ(Gҭ 
3	!@0etG:>v3F'r;D^g!"!x^"
+gMk(xz_{|S;@y[de6ή{Q?=@&σM_(m
+Y3Ye
f	א['zh,~%FNS{Wv/^Οkve\KB1({raXG>-$










w
n
]
T
C
:
)
 


sjYP?6%ofUL;2!








n
]
T
C
:
)
 


										s	j	Y	P	?	6	%				ofUL;2!
(㠿6XnX
Gj kطy
iy<]9±cC$:Jk_hCS(|tS6"AWϕj`dZ?jKc'	ei	F9/0lcmñqb&nIQWڶ&YT5wܸ;G؀GF%GݴvS#\΢D~mc)֜D9	"k?F艘'(i]s77^'esX
r5UdgJ}2g?eG@?P1+Da%{ZRv cn/Pbס(.ҮnsPr_B"x:ڰICQE01jc2ߠLkύ|qsPf#}OȄُ	B~+5
3k[FQC'#܁SyLq'#OQ	g`Ba@h>D
oSTY"}կM-X(YuTD,
H'h|h*	ն|ϿUJ!`qXǂx}VU49,#Ru=hITUvsf'z?co^녤XIÍjH}Mvre2FÖHd3Ҽlsѡb{q[Ry
AU&a`vx@bw_U(7RTgR2ypa*AOYN<EDǟfWG!qO4KF4$,BE	:i9k$3DgKr*wƦ=sI0-ds{Ř8BrB 85+/.b/fܟJ.m:;=21+G#l3x)TsUmgx`JVAUt-[oOlqBv!<	6{}wy
Łw9mҜ7Te#qZWҚl0M_~`4r˦mf:=?_<Q
Aw]5&:,7l1GV.ݱ]e,V
Xj1_oK+	hRO接W)(Ml=䶚##&"|A~_!ޜ%DY~qM
q
y1m:ai;7AJ=Gs.o])^Sf5bƳKtE.ݝ˻XILW_ Sha4xLye\C:!md]$



s
j
?
6
+
"



v_VB9) ~ul^UKB6- 


								t	k	Z	Q	<	3	$				riTK90'zjaMD@7,#yp]TPG@7/&yriYPE</&|of[RB9,#
lastlogrdev.8.gzrawdevices.8.gzramsize.8.gzpivot_root.8.gzmount.8.gzhwclock.8.gzfdformat.8.gzctrlaltdel.8.gzfstab.5.gzsetterm.1.gzrename.1.gznamei.1.gz}column.1.gzzcol.1.gzZREADME.nameiSREADME.colNutil-linux-2.13Jtunelp@setterm;rename:namei/floppy+cytune*column'col"swaponlosetupclockagettyaddpart
remoteraw
libpng12.so.0.10.0
libpng.so.3.10.0fastestmirror.pyssh-keysign.8.gzssh-keygen.1.gzRFC.nroffCREDITSopenssh-4.3p2opensshssh-keygenssh
libauparse.so.0.0.0
libauparse.so.0
libaudit.conf	chkfontpath`dcngettext.3.gz_dcgettext.3.gz^bindtextdomain.3.gzZautosprintf.info.gzNKDEHprojectsFjavaversion.class?serialized-form.html8package-tree.html5GettextResource.html.bindtextdomain.3.html nls.m4lock.m4intl.m4gettext.m4codeset.m4	libgettextpo.alibasprintf.so.0.0.0libasprintf.so.0libfontenc-1.0.2,ChangeLogpython-urlgrabber-3.1.0sslfactory.pyosslfactory.pyc
 !"#$%&'()sed.moZunicode.htmlYtabtest.htmlXspaces.htmlWsgml.htmlSiso88592.htmlElynx.comAjumpsUnix.html@installdirs.html;lynx_url_support.html:lynx_help_main.html9lynx-dev.html5scrolling_help.html4print_help.html0keystroke_help.html.gopher_types_help.html#about_lynx.htmlpdcurses.keydjgpp.keyREADME.sslREADME.jpREADME.chartransFM.announceCHANGES2.7CHANGES2.32pythondoc-elementtree.SimpleXMLWriter.html1pythondoc-elementtree.SimpleXMLTreeBuilder.html/pythondoc-elementtree.HTMLTreeBuilder.html.pythondoc-elementtree.ElementTree.html'README-cElementTree&
READMEXMLTreeBuilder.pyoXMLTreeBuilder.pycTidyHTMLTreeBuilder.pyoTidyHTMLTreeBuilder.pycSimpleXMLWriter.pyoSimpleXMLWriter.pycSgmlopXMLTreeBuilder.pyoSgmlopXMLTreeBuilder.pyc
HTMLTreeBuilder.pyoHTMLTreeBuilder.pyc
ElementTree.pyo	ElementTree.pycElementInclude.pyoElementInclude.pyc$xLrofNE2)	zqcZOF=4/&










x
o
\
S
@
7
(




tk_VKB7.!










z
j
a
W
N
B
9
+
"


											w	m	d	Y	@	6				|ri`WQ@;2,#~wnf]YPMD<3.%qh^UJA4+ 
xod[MD7.!{rvipw.8.gzvigr.8.gzvidmode.8.gzumount.8.gzswapoff.8.gzsfdisk.8.gzsetsid.8.gzrenice.8.gznologin.8.gzisosize.8.gzfsfreeze.8.gzdmesg.8.gzdelpart.8.gzblockdev.8.gzwrite.1.gzwhereis.1.gztaskset.1.gzscript.1.gzlook.1.gzipcs.1.gzipcrm.1.gzhexdump.1.gz|colrm.1.gzwchfn.1.gz`sfdisk.examples]getopt-parse.tcsh\getopt-parse.bashYREADME.mountWREADME.hwclockVREADME.htmlRREADME.clearHreadprofileGrdevFramsizeBul=rev9mcookie2ionice0getopt.flock-fdformat(colcrt%chrtpivot_rootEhwclockfsck.cramfsctrlaltdelmountmorelogin
png.5.gz
	example.c
libpng12.so.0
libpng.so.3ssh-keysigndngettext.3.gzbdngettext.3.gz\gettextize.1.gz[autopoint.1.gzLQVteams.urlKPUteams.htmlEgettext.hDconfig.rpathAngettext.3.html@stylesheet.css<overview-tree.html:index-all.html+gettext-devel-0.17(wchar_t.m4lib-prefix.m4lib-link.m4lib-ld.m4inttypes-pri.m4intldir.m4
libgettextpo.solibasprintf.agettext-po.hautosprintf.hsslfactory.pyprogress.pyoprogress.pycmirror.pyomirror.pyc
grabber.pyo	grabber.pycbyterange.pyobyterange.pyc
sed.info.gzsedfaq.txt.gzTHANKSsed-4.1.5\]^_`abcdefghijklmlynx.moJmild-colors.lssHmailcapFlynx.lss?cernrules.txt/history_help.html,environments.html+edit_help.html(bookmark_help.html&alt_edit_help.html$help_files.txt!lynx_helpwin-386.announceSOCKETSHR.announceREADME.sslcertsREADME.TRST
CHANGES2.6lynx-2.8.5lynxlynx.cfg7simple.xml6simple-ns.xml*effbot.css$
CHANGES#python-elementtree-1.2.6XMLTreeBuilder.pyTidyTools.pyoTidyTools.pycTidyHTMLTreeBuilder.pySimpleXMLWriter.pySgmlopXMLTreeBuilder.pyHTMLTreeBuilder.pyElementTree.pyElementPath.pyoElementPath.pycElementInclude.pycElementTree.so!@0LxL	chkfontpath.8.gz*overview-tree.htmlpackage-listpackages.htmlserialized-form.htmlstylesheet.cssngettext.3.htmltextdomain.3.htmlABOUT-NLSconfig.rpathgettext.hjavaversion.classmsgunfmt.tclprojectsGNOMEteam-addressteams.htmlteams.urltriggerKDEteam-addressteams.htmlteams.urltriggerTPteam-addressteams.htmlteams.urltriggerindexteam-addressautosprintf.info.gzautopoint.1.gzgettextize.1.gzbind_textdomain_codeset.3.gzbindtextdomain.3.gzdcgettext.3.gzdcngettext.3.gzdgettext.3.gzdngettext.3.gzgettext.3.gzngettext.3.gztextdomain.3.gz/usr/bin//usr/include//usr/lib//usr/share/aclocal//usr/share/doc//usr/share/doc/gettext-devel-0.17//usr/share/doc/gettext-devel-0.17/javadoc2//usr/share/doc/gettext-devel-0.17/javadoc2/gnu//usr/share/doc/gettext-devel-0.17/javadoc2/gnu/gettext//usr/share/gettext//usr/share/gettext/projects//usr/share/gettext/projects/GNOME//usr/share/gettext/projects/KDE//usr/share/gettext/projects/TP//usr/share/info//usr/share/man/man1//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnu


								ASCII C program textASCII English textASCII textBourne shell script text executableELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippedHTML document textXML document textcurrent ar archivedirectorysymbolic link to `libasprintf.so.0.0.0'symbolic link to `libgettextlib-0.17.so'symbolic link to `libgettextpo.so.0.4.0'symbolic link to `libgettextsrc-0.17.so' !"#$
RRRRPR	R
RRRRRRRRRRRPR	R
RRR
RRRRRRRRRRRRR?j3a(dbIֈ?Mt٨GV(MSVVactj8ur
ˈ?Mt٨GV(KVKKv(PhCHMx+f2N&x1b84499663165606e4049550420b781f4661be75NsFNs:of "" as identical to those
  without- Added "--append" and "-o" to msghack, which should address 
  initial concerns in #50065- New msghack - from scratch, in python- msghack is back- Include some docfiles- 0.10.38
- do not include charset.alias- Build statically.- 0.10.37
- Disable all but two patches- Initialize proper fonts when entering po-mode (#29152)- More fix about msgmerge.- Fix for msgmerge not to break multibyte strings
  at Japanese locale.- fixed the %lang generator to not have "./" in the lang- add an init file for the emacs po-mode
- update source URL- put gettext in /bin for initscripts use
- %langify- prereq /sbin/install-info- Added patch from Ulrich Drepper- update DESTDIR patch (#12072)- automatic rebuild- fix problems wrt to DESTDIR (#12072)- use FHS paths
- add buildroot patch for .../intl/Makefile.in, was using abs. install path- minor configure tweaks for ia64- add --comments to msghack- fix bug #9240 - gettextize has the right aclocal patch- add the --diff and --dummy options- add the --missing option to msghack- updated msghack not to merge in fuzzies in the master catalogs- updated msghack to understand --append- updated msghack to correctly deal with sorting files- msghack updates- auto rebuild in the new build environment (release 8)- added patch for misc hacks to facilitate rpm translations- patch to allow to build on ARM- add Emacs po-mode.el files.- include the aclocal support files- remove devel package (functionality is in glibc)- update to 0.10.35.- add gettextize.
- create devel package for libintl.a and libgettext.h.- translations modified for de, fr, tr- added info handling
- added misc-patch (skip emacs-lisp modofications)- removed locale.aliases as we get it from glibc now
- uses a buildroot- Built against glibc/bin/sh/bin/sh/sbin/ldconfigbuilder10.centos.org 1299376128!# !"#$&%'()*+,-./01234DOJKLQ]^RTYUWXa_[hedfbMN:

	0.17-1.el5						








autopointgettextizeautosprintf.hgettext-po.hlibasprintf.alibasprintf.solibasprintf.so.0libasprintf.so.0.0.0libgettextlib.solibgettextpo.alibgettextpo.solibgettextpo.so.0libgettextpo.so.0.4.0libgettextsrc.socodeset.m4gettext.m4glibc2.m4glibc21.m4iconv.m4intdiv0.m4intl.m4intldir.m4intlmacosx.m4intmax.m4inttypes-pri.m4inttypes_h.m4lcmessage.m4lib-ld.m4lib-link.m4lib-prefix.m4lock.m4longlong.m4nls.m4po.m4printf-posix.m4progtest.m4size_max.m4stdint_h.m4uintmax_t.m4visibility.m4wchar_t.m4wint_t.m4xsize.m4gettext-devel-0.17ChangeLogbind_textdomain_codeset.3.htmlbindtextdomain.3.htmlgettext.3.htmljavadoc2allclasses-frame.htmldeprecated-list.htmlgnugettextGettextResource.htmlpackage-frame.htmlpackage-summary.htmlpackage-tree.htmlhelp-doc.htmlindex-all.htmlindex.htmlm>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- backport 0.17 from RHEL6 (#523713):
- update License to GPLv3 and LGPLv2+
- set preloadable_libintl.so executable in %install so it gets stripped
- fix encoding of msghack script (Dwayne Bailey, #250248)
- fix autopoint messing up CVS files with upstream patch (#441481)
- add upstream gettext-xgettext-python-unicode-surrogate-473946.patch
  to fix xgettext handling of utf16 surrogates in python (#473946)
- msghack.py: add arg checking and usage help (dchen, #456666)
- drop java support and libintl.jar since needs gcj > 4.3 and openjdk
- remove examples from -devel package
- do not own en@*quot locale dirs
- use %find_lang for .mo files
- drop superfluous po-mode-init.el source- reset timestamp of examples ChangeLog for brp-java-repack-jars to really fix
  libintl.jar multilib conflict (#222156)- buildrequire zip and unzip to fix libintl.jar multilib conflict (#205207)- move libgettext*.so devel files to devel package (Patrice Dumas, #203622)- update to 0.14.6
- include preloadable_libintl.so again (Roozbeh Pournader, #149809)
- remove .la files (Kjartan Maraas, #172624)
- cleanup spec file- Bump release number.- rebuild- --disable-csharp, otherwise it'll build a dll when mono is 
  installed in the buildroot.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt again- rebuilt- convert spec to UTF-8
- remove old tarballs from sources- updated to 0.14.5
- Add cvs as Requires for gettext-devel- updated to 0.14.3
- fixed compiling problem on gcc4 (#150992)
- fixed Group for -devel (#138303)
- moved gettextize and autopoint to -devel (#137542, #145768)
- moved some of the man pages- rebuilt with gcc 4.0- Add env var to redirect use fastjar instead of jar
- BuildRequires /usr/bin/fastjar and libgcj- fix call on phase0_getc()
- fix temp file issue (#136323 - CAN-2004-0966 - mjc)- fixed typo on %preun on -devel- fix install_info
- add gcc-java build requirement- move java stuff to gettext-devel (#132239)
- add BuildRequires: gcc-c++ (#132518)
- add some missing install-info and ldconfig (#131272)
- fix dir ownership (#133696)
- run autotools for 1.9- rebuilt- use --without-included-gettext to avoid the need of libintl.so (#125497)
- remove preloadable_libintl.so- moved some of the shared lib to main pkg
- added more build requires- add conditionals for patch and requires auto* (#125216)- packaged lib files for devel
- moved some of the files to different sub-pkg
- fix problem on x86_64 build- rebuilt- rebuilt- rebuilt to 0.14.1- rebuilt 0.12.1
- fix including files and excludes some patches- rebuilt- 0.11.5- rebuilt- add online help for msghack replacement- add patch to fix gettextize (#78720)- remove unpackaged files from the buildroot- Use %{_libdir} instead of /usr/lib (#72524)- install ulonglong.m4, which is required by uintmax_t.m4, which is already
  being installed- 0.11.4- automated rebuild- automated rebuild- 0.11.2
- include some new files- Add patch to make it compile with C99 compilers (#62313)- 0.11.1- update gettext to 0.11
- disable patch4- automated rebuild- improve automake handling- Add URL
- Add automake workaround (#56081)- 0.10.40 - libintl is now LGPLed (it was GPLed). Note that RHL
  uses the glibc version, and don't include libintl from gettext.
- include new man pages
- don't include the elisp mode - bundle it into the main emacs package,
  like we do for XEmacs.
- README-alpha no longer exists, so don't list it as a doc file- Rebuild - this should fix #52463- Fix handling of multiline entries (rest of #50065)
- don't use the references of the last entry in a po file
- remove duplicates when inverting
- Own the en@quot and en@boldquot locale dirs (#52164)
- Handle entries with a first line 4@@@@@@@@@@@@JJ@/bin/sh/bin/sh/bin/sh/sbin/ldconfigcvsgettextinfoinfolibasprintf.so.0libc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libgcc_s.so.1libgcc_s.so.1(GCC_3.0)libgettextlib-0.17.solibgettextpo.so.0libgettextsrc-0.17.solibm.so.6libstdc++.so.6libstdc++.so.6(CXXABI_1.3)libstdc++.so.6(GLIBCXX_3.4)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)0.17-1.el53.0.4-14.0-14.4.2.3Lu`E`E!DrD׷DƔ`DpCCC`CC`C;`B`B?CB$A>AA`v`A]`AF`@q`@6@Ó@`@M@E@-H@`?k|`>k>¼`>/`>'+`=`=@`=mG=K=Di`=<f`<<`<<p'<<`<;`; ;`;+`;s;WX`;T`;;`:`:`:`:\:\:oP`:b!`:^,:M	`9I`9<9n;9jG`9R`9
	8`848|`7`7Q`7Ÿ7`726k6H`6g	65@`5`5n`5`5D4\4[`3B`Jens Petersen <petersen@redhat.com> - 0.17-1.el5Jens Petersen <petersen@redhat.com> - 0.14.6-4.el5Jens Petersen <petersen@redhat.com> - 0.14.6-3Jens Petersen <petersen@redhat.com> - 0.14.6-2Jens Petersen <petersen@redhat.com> - 0.14.6-1Thomas Fitzsimmons <fitzsim@redhat.com> - 0.14.5-4Jesse Keating <jkeating@redhat.com> - 0.14.5-3.1Karsten Hopp <karsten@redhat.de> 0.14.5-3Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.2Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.1Jesse Keating <jkeating@redhat.com> 0.14.5-2.2Jesse Keating <jkeating@redhat.com>Jindrich Novy <jnovy@redhat.com> 0.14.5-2Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Jakub Jelinek <jakub@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Tim Powers <timp@redhat.com>Leon Ho <llch@redhat.com> 0.11.4-6Leon Ho <llch@redhat.com> 0.11.4-5Tim Powers <timp@redhat.com> 0.11.4-4Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-3Nalin Dahyabhai <nalin@redhat.com> 0.11.4-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.11.2-1Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-1Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-3Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-2Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-1Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-7Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-6Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Matt Wilson <msw@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.co8deacddd018ae1252d48faca997227b79e116673efd99e1b84e2c1f37327f97f453319eb72eb5cb36669ca5165f0efe0c7113051e438a2879930599478959b599f311119b9e0b1fc62875005749c1989cdec2e53a8af9795fa9b88415638279c018b3b8177a5901e77ec7ec8d3c6871a0d273d37da58fd332002070e9f6f318c8b94f90a58b05cef11c9b333c183e6b301fb57ed806c5fa4c0c9f2beb0b98851f44bf9117b0f36114678c3f0f150801c7f8651047403fb250559764c5f067c4d200854aedc47dafb9e5cc9851106b6ea922334277c448433fba0b825e8427650c735817a7c60d72809dfc58fceafd3c5ee7ff5fe387681982e8686194da987ff1eff5248cd4546ec67d6febe5a3798f7c4f12e9ce15810d3f65c6b4a7b7bc3d2e06b437bb992d34d0d4d7b66af970014fc2603adb14bec176cc24a551176eed32712769a8ecac7c7710bc80180c3a48ada1c86e01f8aa4deb46e88998fd27289fe4f3695d7337cbcfd782e23c2957890f111646b6a33c9a2731e795bd7dd048948211beb190fff315f7e0d980183900aab34c0464cc61f1f6b5a080b27b5b4c1a160d2bed1fcfaf9f997e6d6329fdd69c134439110922c96bfa3b4dda702716fa2307902f7be5e48670db60a5939769e23e8396c1d5851091edddb476fcb8bd53e623c1d95ca0cea2216652931fe34e9811cb9af03305d9e1d13d54d765a707363fa0c684a2a269aa0e0e1f01575fd12053e7689d9261c9c763e25facf4da380d363834d4700078cd014de27ab42705dd92013bed4b83c06befd4c8000788c247e90af1c42671cddd4e1421465eb9f66395e0cb629be0da63132acbd01f9f7aab4c66d0202553ca54c8d33577dcb83b47d8800b47f046f525800b44c4619ce24145c3901e9a80dcd33b6aa81b1f092d1aca4551cb96f013040bb713aa9daedab60388e883c926591b01b2f2426d7e272f1e6b62567315a96955428cddcde69a780d0a55ee408a590a75c0088674e456f6a6079078e17ac392a61a7fc4cc2226e80ebae4d1d5dc64b5b42c0615a2b294832e1962fd23854adbf06efa9e279b0c640bbc8bc4bb80a9ba7cec3f87b2c00cff5cfc918fea75831029e35d7a463d736a5ebe2d1648ef9d999290e33a2fb777550d7ff12d903da16d29e35d7a463d736a5ebe2d1648ef9d999290e33a2fb777550d7ff12d903da16d6dc3b171b66226df6e90f49100894951750afc99058092a77d927ea343be00bfe7dfd73cd05fdaa7192571c527f2e29elibasprintf.so.0.0.0libasprintf.so.0.0.0libgettextlib-0.17.solibgettextpo.so.0.4.0libgettextpo.so.0.4.0libgettextsrc-0.17.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgettext-0.17-1.el5.src.rpmlibasprintf.so.0libgettextpo.so.0gettext-devel@	@@@@@@@@@@@
$IY?Xd		9(,DHQX	`rpff	f
f8ff
fff0fp\(8[9[:,@[>B?B'@B/FB>GB`fHCfIEfXEYF\Ff]Gf^M
bNdO{eOfOkOlOtOfuQ<fvRwTXfxUfyW%{XfXXXAXA
Y*YTYXfYgYhYCgettext-devel0.171.el5Development files for gettextThis package contains all development related files necessary for
developing or compiling applications/libraries that needs
internationalization capability. You also need this package if you
want to add gettext support for your project.MrTbuilder10.centos.orgwCentOS-5CentOSLGPLv2+Development/Toolshttp://www.gnu.org/software/gettext/linuxi386/sbin/ldconfig
/sbin/install-info /usr/share/info/autosprintf.info /usr/share/info/dir || :if [ "$1" = 0 ]; then
  /sbin/install-info --delete /usr/share/info/autosprintf.info /usr/share/info/dir || :
fiIH9p9x%	*	u	j
Yt-0,Ih
[JXzd(h2&
5*G%	3_=1&L.Y
x'('(q!큤A큤A큤AA큤큤AA큤A큤A큤큤큤MrbMrbMrqMrMrSMr=Mr=MrSMr?MrSMrBMrBMrSMr@E>~G$AjAjG$G$G$E>~G$E>~E>~DAjAiSG$PC5^G$G(nDJ:G$G$AjE~%DG(nBnAjG$AjMrTG0L>QS>QS>QSG1):>Lw>LG1):G1):>L>L>L>L>L>L>L>LF	ֿ>L>L>L>QS>QSG*F]G(vEjG	5MrBMrBBB>LBMrB>L>L>LBMrBF?F-FC>LQ>L[>LfF}G1G1G1zG1z>QL>QL>QL>QLG1yG1yG1y03f2ca5c84507e511f2963f6fc415a98436c9cba4117ed0353ad637f7020751a6eccede122cae218199caad7a4f52881c9572fea4fbb469f79f6fa7046eb8b8f53ecc57ccfd968390513a8dcf3e5c66b9f50e76623827fca7dc34fbfc884f8a396eddcac9eaa902ec823f7469c379d1c3517f39469a1ac6f3849dcd929f69b6c63141118a332dfa04cd26bcf8d7c7173dab0e2ad4943514530c50faef831db6a3e10b5f9275234d8669363fa6fb353dfe407d1feb1ef8e05eb7a79954d6a62d254b7ef5e957ea5331a19790363d38f01990e2c4cdc262636abf4e7cf0b8cb7de4872a57ab3c73f5afe6ec81df6fa179e6ec6c60cd359715730336ae8bd2f5d4c3fa9f7ef2f1e212999c2f12b5b8fa6309328ce4e916468fa5e64d949bcca29bb7e26fe00a32ce3bf457b6133ed3dc14e4e09bc5cde5585d481920d30dbb60ad972b05f161e4295bebda622e978ec3a9b4a695a584ba1673823d08f782214ec0bd8679cf4a25e4cf870c5cf6629a242d79c7b56be0858201c47702461a439f9bf1d282ed2ae6e73a4081213509da7e303760320abfa636e2fa00b508362a7d7a1819c8e2ebb3b017d16dad3563cba360a4eafab509f1cc0c70f3281bec07fd77f8d4fb069fefb21f68f6b70c755c3d84a4fe3f809b636d924d9d3377197179d100aa14b2949a96f8bea30e2cc5ea47d3ba4f801a4817b8f5aa|ZG[QD*
f:VCRݢ0縮{(>tx	System Environment/Base
System Environment/LibrariesO
*o match RC3 upstream.- rebuilt- Bump xorg-x11-filesystem dep to >= 0.99.2-3 as -2 had bugs.- Added libfontenc-0.99.2-use-datadir-for-encodings.patch and invoke aclocal
  and automake to activate the changes.  This fixes a bug reported against
  mkfontscale, in which it looks in _datadir for the font encodings files,
  which was traced back to libfontenc (#173875).
- Added "Requires(pre): xorg-x11-filesystem >= 0.99.2-2" to ensure that
  /usr/include/X11 is a directory rather than a symlink before this package
  gets installed, to avoid bug (#173384).- Updated libfontenc to version 0.99.2 from X11R7 RC2
- Changed 'Conflicts: XFree86-devel, xorg-x11-devel' to 'Obsoletes'
- Changed 'Conflicts: XFree86-libs, xorg-x11-libs' to 'Obsoletes'- Updated libfontenc to version 0.99.1 from X11R7 RC1- Renamed package to remove xorg-x11 from the name due to unanimous decision
  between developers.
- Use Fedora Extras style BuildRoot tag.
- Disable static library creation by default.
- Add missing defattr to devel subpackage
- Add missing documentation files to doc macro- Added zlib-devel build dependency- Renamed package to prepend "xorg-x11" to the name for consistency with
  the rest of the X11R7 packages.
- Added "Requires: %{name} = %{version}-%{release}" dependency to devel
  subpackage to ensure the devel package matches the installed shared libs.
- Added virtual "Provides: lib<name>" and "Provides: lib<name>-devel" to
  allow applications to use implementation agnostic dependencies.
- Added post/postun scripts which call ldconfig.
- Added Conflicts with XFree86-libs and xorg-x11-libs to runtime package,
  and Conflicts with XFree86-devel and xorg-x11-devel to devel package.- Initial build./sbin/ldconfig/sbin/ldconfigXFree86-libsxorg-x11-libsbuilder6 1173896812								1.0.2-2.2.el5libfontenc.so.1libfontenc.so.1.0.0libfontenc-1.0.2AUTHORSCOPYINGChangeLogINSTALLREADME/usr/lib//usr/share/doc//usr/share/doc/libfontenc-1.0.2/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII English textASCII textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectoryemptysymbolic link to `libfontenc.so.1.0.0'	RPRRRRRRR	R? Hbݢ0縮{(>?F9GV(To=S[`ǡ\JH‹8U=vPMQ>펹]?F9GV(,@UOY ?e\YQTӧ)pK̳˔eb0bfb1d2815fc9603c58cd6f2db267fba27af67NsBbNs:N
H?d
		@hlx|		
$
(Px


(8$9l:>@$B3FNGdHIXYZ[\]^Nbd*e/f4k6l;tTutvw0xPyp
{AA
Fpt|ghClibfontenc1.0.22.2.el5X.Org X11 libfontenc runtime libraryX.Org X11 libfontenc runtime libraryE>builder6]nCentOSMIT/X11System Environment/Librarieshttp://www.x.orglinuxi386TA큤E>E>E>B$C߬DO5B$B$c00662450784ed5c18881bde596857ced41d8cd98f00b204e9800998ecf8427e4641deddaa80fe7ca88e944e1fd94a94d6506386cb26bdbdc69c730e6c54e4d0d41d8cd98f00b204e9800998ecf8427ed41d8cd98f00b204e9800998ecf8427elibfontenc.so.1.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibfontenc-1.0.2-2.2.el5.src.rpmlibfontenc.so.1libfontenc@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfiglibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libfontenc.so.1libz.so.1rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-14.4.2EDpD`DQ>CC`Cκ`C8CD`C`C`CCu`C]Y`C<cCC`C
JAdam Jackson <ajax@redhat.com> 1.0.2-2.2Jesse Keating <jkeating@redhat.com> - sh: line 0: fg: no job controlMike A. Harris <mharris@redhat.com> 1.0.2-2Adam Jackson <ajackson@redhat.com> 1.0.2-1Jesse Keating <jkeating@redhat.com> 1.0.1-1.2Jesse Keating <jkeating@redhat.com> 1.0.1-1.1Mike A. Harris <mharris@redhat.com> 1.0.1-1Mike A. Harris <mharris@redhat.com> 1.0.0-1Mike A. Harris <mharris@redhat.com> 0.99.3-1Jesse Keating <jkeating@redhat.com>Mike A. Harris <mharris@redhat.com> 0.99.2-3Mike A. Harris <mharris@redhat.com> 0.99.2-2Mike A. Harris <mharris@redhat.com> 0.99.2-1Mike A. Harris <mharris@redhat.com> 0.99.1-1Mike A. Harris <mharris@redhat.com> 0.99.0-4Mike A. Harris <mharris@redhat.com> 0.99.0-3Mike A. Harris <mharris@redhat.com> 0.99.0-2Mike A. Harris <mharris@redhat.com> 0.99.0-1- Add BuildRequires on xorg-x11-font-utils to fix encodings path.  (#220040)- rebuild- Remove package ownership of mandir/libdir/etc.
- Added "BuildRequires: autoconf" temporarily as long as autoconf is needed- Update to 1.0.2- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Updated libfontenc to version 1.0.1 from X11R7.0- Updated libfontenc to version 1.0.0 from X11R7 RC4
- Added libfontenc-1.0.0-get-fontdir-from-pkgconfig.patch which now replaces
  libfontenc-0.99.2-use-datadir-for-encodings.patch by using pkgconfig to
  query fontutil.pc for fontdir.
- Added "BuildRequires: font-utils >= 1.0.0" to find fontutil.pc
- Removed libfontenc-0.99.2-use-datadir-for-encodings.patch- Updated libfontenc to version 0.99.3 from X11R7 RC3
- Added "Requires(pre): xorg-x11-filesystem >= 0.99.2-3", to ensure
  that /usr/lib/X11 and /usr/include/X11 pre-exist.
- Removed 'x' suffix from manpage directories t	ȁ
z <katzj@redhat.com> - 2.9.6-4Jeremy Katz <katzj@redhat.com> - 2.9.6-3Phil Knirsch <pknirsch@redhat.com> 2.9.6-2Jeremy Katz <katzj@redhat.com> - 2.9.6-1Jeremy Katz <katzj@redhat.com> - 2.9.5-1Seth Vidal <skvidal@phy.duke.edu> 2.9.5-0Seth Vidal <skvidal@phy.duke.edu> 2.9.3-0- Fix user and password quoting in URLs
- Resolves: rhbz#576651
- Fix serial line progress output
- Resolves: rhbz#500912- Fix keepalive for HTTP.
- Resolves: rhbz#471224- Import fixes from Fedora, and UI progress tweaks
- FTP byterange with specified port
- reget with HTTP servers that don't support Range
- Dynamic resizing progress, with totals and visible end state
- Resolves: rhbz#435156
- Resolves: rhbz#444085
- Fedora-Bug: 404211
- Fedora-Bug: 419241
- Fedora-Bug: 437197- fix unicode problems
- Related: rhbz#384691- fix keepalive (#218268)- update to 3.1.0- Add support for byte ranges and keepalive over HTTPS- rebuild- update to 2.9.9- catch read errors so they trigger the failure callback.  helps catch bad cds- update to new version fixing progress bars in yum on regets- rebuilt- don't use --record and list files by hand so that we don't miss 
  directories (#158480)- add directory to file list (#168261)- Fixed the reget method to actually work correctly (skip completely transfered
  files, etc)- update to 2.9.6- import into dist
- make the description less of a book- 2.9.5- first package for fc3
- named python-urlgrabber for naming guideline compliancebuilder10.centos.org 1299373377""""""""""""""""""""""""""""3.1.0-6.el53.1.0-6.el5urlgrabberurlgrabber__init__.py__init__.pyc__init__.pyobyterange.pybyterange.pycbyterange.pyograbber.pygrabber.pycgrabber.pyokeepalive.pykeepalive.pyckeepalive.pyomirror.pymirror.pycmirror.pyoprogress.pyprogress.pycprogress.pyosslfactory.pysslfactory.pycsslfactory.pyopython-urlgrabber-3.1.0ChangeLogLICENSEREADMETODO/usr/bin//usr/lib/python2.4/site-packages//usr/lib/python2.4/site-packages/urlgrabber//usr/share/doc//usr/share/doc/python-urlgrabber-3.1.0/-O2cpiogzip9noarchnoarch-redhat-linux-gnuASCII English texta /usr/bin/python -t script text executabledirectory	

RRRRRRRRRRRRRRRRRRRRRRR?`yOj0\J?MtVGV($'׵wS! KDѵX5Aꓸ?MtVGV(;vh(KTW=jr?r11]	Ecn00a7efceb00797d0f2b28eb083a79e597997a820NsatNs	pD?d	 	H%,	4Ju{	,
d0
LHl	"(	D8	L9	:FdGHIdXY\]^ibdefk
lt,uvwXxy8{AA
VghCpython-urlgrabber3.1.06.el5A high-level cross-protocol url-grabberA high-level cross-protocol url-grabber for python supporting HTTP, FTP
and file locations.  Features include keepalive, byte ranges, throttling,
authentication, proxies and more.MrCbuilder10.centos.orgNCentOS-5CentOSLGPLv2+Development/Librarieshttp://linux.duke.edu/projects/urlgrabber/linuxnoarchC0=d<ʗʗRaJJF??i]T]T
q
qp_E$A큤A큤MrBMrBE5OMrBMrBMrAMrBMrBMrAMrBMrBE5MrBMrBMrAMrBMrBMrAMrBMrBE5MrBMrBMrBE5X@jBU9CZ118ab486e9175f6f3d3580f0a96da736b5ee228e7dd5af4dba11f012a22db25870f27eb9522e924788487ef594172d7970f27eb9522e924788487ef594172d79fb056de37023ec031dc21e60952a19d8f81fef9d5fad53b1063f1f6664b09160f8e06897601c543ae8cd596b6af37afa13daf9ae586f0fe9c432163c49f050ca2b25c1933f4792e8e69734b5e13672452b25c1933f4792e8e69734b5e136724527392a870591b871e2bad020a2af1c7917bf6f82e6a7fb53e3aa54cd59f8e1af17bf6f82e6a7fb53e3aa54cd59f8e1afe9c0eb139e16288583f6abf44901f5a5b56042071f6140f3e7b168803e44c117b56042071f6140f3e7b168803e44c117f23c19f14921e8d075592b59425bc1f2d70a17f4f787622d786ad4486e031a9bd70a17f4f787622d786ad4486e031a9b71eb27c0f5234f1e510907eaa067bcdff3b40123c9dc81539979bd4cb7c70284f3b40123c9dc81539979bd4cb7c702842b350a336b5b044651b08c43e8c427cb68ad62c64cc6c620126241fd429e68fec0cae22e4e596b4c44afd5780845975212b35c807c24b068e55690fe99274fcarootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-urlgrabber-3.1.0-6.el5.src.rpmurlgrabberpython-urlgrabber@@JJJ/usr/bin/pythonm2cryptopython(abi)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rpmlib(VersionedDependencies)0.16-52.43.0.4-14.0-13.0.3-14.4.2.3Lc`IQHG!`Ew=`E=;`D`DpDjK`D<CC`C1C(`BB. `B,B,BN`James Antill <jantill@redhat.com> - 3.1.0-6James Antill <jantill@redhat.com> - 3.1.0-5James Antill <jantill@redhat.com> - 3.1.0-4James Antill <jantill@redhat.com> - 3.1.0-3Jeremy Katz <katzj@redhat.com> - 3.1.0-2James Bowes <jbowes@redhat.com> - 3.1.0-1James Bowes <jbowes@redhat.com> - 2.9.9-2Jesse Keating <jkeating@redhat.com> - 2.9.9-1.1Jeremy Katz <katzj@redhat.com> - 2.9.9-1Jeremy Katz <katzj@redhat.com> - 2.9.8-2Jeremy Katz <katzj@redhat.com> - 2.9.8-1Jesse Keating <jkeating@redhat.com>Jeremy Kat~~
libpngopenssh
audit-libs	chkfontpathgettext-devellibfontencsedPOvRRRRRR	R
R
? m4'&0҈?MSGV(C束\IX)a[<rfa$~~?MSGV($*x@Fx??Ͳ	OImt*7ac04a77fd831e604eaf7c92978cd5e2a51fbdbdNs|/usrNsX>print current buffer after N command on the last line
  unless POSIXLY_CORRECT (#112952)
- adjust XFAIL_TESTS for the improved glibc regex implementation
  (#112642)- enable --without-included-regex again
- use fastmap for regex searching- update to 4.0.8
- simplify specfile
- disable --without-included-regex to pass the testsuite- rebuilt- rebuilt- update to 4.0.7
- use "--without-included-regex"
- do not gzip info pages in spec file, "TODO" is not present anymore- update to 4.0.5- rebuilt to fix x86-64 miscompilation
- run make check in %build- automated rebuild- automated rebuild- Remove stale URLs from documentation (#62519)- Bump release + rebuild.- Update to 2000.11.28 patch
- Rebuild for 7.1 tree- automatic rebuild- FHS packaging.- compress man pages.- rebuild with glibc 2.1.3 to fix an mmap64 bug in sys/mman.h- auto rebuild in the new build environment (release 4)- update to 3.02- update to 3.01- translations modified for de, fr, tr- removed references to the -g option from the man page that we add- spec file cleanups
- added BuildRoot- built against glibc/bin/sh/bin/shbuilder10.centos.org 1304522200qqqqqqqqqqqoqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqafcacsdadeeleoesetfifrgaglhehrhuiditjakonlplptroruskslsrsvtrzh/usr4.1.5-8.el5	

 !"#sedsed-4.1.5AUTHORSBUGSNEWSREADMETHANKSsedfaq.txt.gzsed.info-1.gzsed.info-2.gzsed.info.gzsed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.mosed.1.gz/bin//usr/share/doc//usr/share/doc/sed-4.1.5//usr/share/info//usr/share/locale/af/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII C++ program textASCII English textASCII textELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippeddirectory`-ootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsed-4.1.5-8.el5.src.rpmsed@	@@@@@@@@@JJ@/bin/sh/bin/sh/sbin/install-infoglibclibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)2.3.3-283.0.4-14.0-14.4.2.3MyIMw`Mw`DDqD`DpDM`DM`DM`CC`CC`B9B*+Ag
A_$A*h@@Z`@q`@@-H?`?P`?`>l>k>`>0e=`=<f`<`;6b:>9l`9<"8@`8`6k5`55D4O4G3B`Vojtech Vitek (V-Teq) <vvitek@redhat.com> - 4.1.5-8Vojtech Vitek (V-Teq) <vvitek@redhat.com> - 4.1.5-7Vojtech Vitek (V-Teq) <vvitek@redhat.com> - 4.1.5-6Petr Machata <pmachata@redhat.com> - 4.1.5-5Petr Machata <pmachata@redhat.com> - 4.1.5-4Petr Machata <pmachata@redhat.com> - 4.1.5-3Jesse Keating <jkeating@redhat.com> - 4.1.5-2.2.1Petr Machata <pmachata@redhat.com> - 4.1.5-2.2Petr Machata <pmachata@redhat.com> - 4.1.5-2.1Petr Machata <pmachata@redhat.com> - 4.1.5-2Jesse Keating <jkeating@redhat.com> - 4.1.5-1.2Jesse Keating <jkeating@redhat.com> - 4.1.5-1.1Florian La Roche <laroche@redhat.com>Jesse Keating <jkeating@redhat.com>Jakub Jelinek <jakub@redhat.com> 4.1.4-1Jakub Jelinek <jakub@redhat.com> 4.1.2-5Jakub Jelinek <jakub@redhat.com> 4.1.2-4Jakub Jelinek <jakub@redhat.com> 4.1.2-3Florian La Roche <Florian.LaRoche@redhat.de>Jakub Jelinek <jakub@redhat.com> 4.1.1-1Jakub Jelinek <jakub@redhat.com> 4.1-1Elliot Lee <sopwith@redhat.com>Jakub Jelinek <jakub@redhat.com> 4.0.9-1Elliot Lee <sopwith@redhat.com>Jakub Jelinek <jakub@redhat.com> 4.0.8-3Jakub Jelinek <jakub@redhat.com> 4.0.8-2Florian La Roche <Florian.LaRoche@redhat.de>Jakub Jelinek <jakub@redhat.com> 4.0.7-3Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Jakub Jelinek <jakub@redhat.com> 4.0.5-1Jakub Jelinek <jakub@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Jakub Jelinek <jakub@redhat.com>Elliot Lee <sopwith@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Prospector <bugzilla@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jakub@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>- Do not update sedfaq.txt file from upstream sources on every build,
  use CVS version instead.- Fix multilib regression (non-equal 32/64bit content) by touching
  the generated sedfaq.txt.gz file with an exact timestamp- Fix regression in handling of relative symlinks
  Resolves: #490473
- Fix multibyte characters syntax error and possible infinite loop
  Resolves: #527427- Fix handling of relative symlinks (#205122)- remove superfluous multibyte processing in str_append for UTF-8
  encoding (thanks Paolo Bonzini, #177246)- use dist tag- rebuild- typo in patch name- rebuild- #185374:
  - Follow symlinks before rename (avoid symlink overwrite)
  - Add -c flag for copy instead of rename (avoid ownership change)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- 4.1.5- rebuilt- update to 4.1.4- rebuilt with GCC 4- fix up make check to run sed --version with LC_ALL=C
  in the environment (#129014)- add sedfaq.txt to /usr/share/doc (#16202)- update to 4.1.2- update to 4.1.1- update to 4.1- rebuilt- update to 4.0.9
- BuildRequire recent glibc and glibc-devel (#123043)- rebuilt- if not -n, hI-?,{d		,x|	t+ +	v+
+x+	+

+
++j+
0
4
li(809T0:0>?FG+H `+I!+J!uX!|Y!\!+]"8+^#~$b'd(e(f(k(l(t(+u)l+v*w*+x++y,0{,P+,,,A,A
-"-L-P+-|K-g-h-Csed4.1.58.el5A GNU stream text editor.The sed (Stream EDitor) editor is a stream or batch (non-interactive)
editor.  Sed takes text as input, performs an operation or set of
operations on the text and outputs the modified text.  The operations
that sed performs (substitutions, deletions, insertions, etc.) can be
specified in a script file or from the command line.Mnbuilder10.centos.orgCentOS-5CentOSGPLApplications/Textlinuxi386/sbin/install-info /usr/share/info/sed.info.gz /usr/share/info/dirif [ $1 = 0 ]; then
   /sbin/install-info --delete /usr/share/info/sed.info.gz /usr/share/info/dir
fih\A.>-He%I	"&%ymo%#k$&&5f3%L	g
A큤MnMnBBCBCƨvMmMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMnMn8b4f313fc7655d2a610779fc08a5fea37357ae38fef6772b8c5e8639769a80e3fa136ab8b28f487d15e47f4d761cfd728c2a4e482a47ac0e0d63bc3b96a77e26636f5eeb85a4f99b945849d919b6c38de693767366d327c77a3ffafeaa07d4086d150ed65c77e5b6c37dc7e1336aeba473f099555cf6de94d8f2aa3c16f084359302542905b63aecf5cfdeefafb68de2b5933287597c4641e2aefde87250f6aa36a0e018872efcbb3c8fc5202bfc059952e4a175e80c3dd968c64954eaab55b6d2a9c124fbbb1beeb6038efc9b8dffdfd6347d166700df5dc1c349876b669ba65be96fda60b116636bb26258787d1f6a5518b5181fa634e8f739fe922cab238276f2bdcc0a6026d4a2fa226cc8fcb7b1c7820878e5cc7d9af47fd456cfd311e2c3a82b5f14109379373091f94e216b2ccfbf4f5dad73b789241edc738acc985b9b4ef098b56e92ccf0d4e1744a59f139216554a1515e1d3fb46f53609a2c908f87c75b252b081c9821716379008e78d9667e14d716bb720b7e9642d6d94d1100cb27b67582306aab26ea84b924f828f9891a464c758d8166c0e11715b68b709aa4879f92d35855b23bbfe8a9472644b6549dc640966a34d48ea3a4b1ebdbf59b100cbfb27afc3a9e34d798ef17bed97394564d56cfe42d543f16dd76a5740a424a24c269f30bdb2323080e0a9b73f1e1aa6c4e7f1e9bd54c507c2c934abd3efdcfd21f83f9ea08607158b0aba418b1d47148fb1df4a1e0d292630b68eb3a402f57dca6a907b9222803fef0357dd672efafccfa9c7a19c035df20359725aff33847b7fc32ddaa26c104628972b9a8be8a2c509b4434de3ebf3eecc0001a1eb404687c68e5e02a09d5b67ce5cfbf55064afc9eef0c59ab759f54d3dc442c0a7f4850c83223fe339c699ada2864debf02bcf0648adf4cb75d65838eb6695bdd8bcfrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootr@tomcat5-admin-webappstomcat5-webappseclipse-ecj(&,suэh^tomcat5gjdoca&,suэh^&,su,/var/lib/rpmrebuilddb.5717/Triggername 

4t?d		Gpt	W(f)l*+-,4-H8\9`:BDXYZ[bdefkldef(,
<hglhpCvzdummy-jre-el51.01.swsoftDummy package to fix jre uninstallationDummy package to fix jre uninstallationGtemple.eng.sw.ruSWsoftGPLParallels Linux TeamApplications/Systemlinuxnoarchvzdummy-jre-el5-1.0-1.swsoft.src.rpm|vzdummy-jre-el5JJ/bin/shrpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)4.0-13.0.4-12.2.0echo "#!/bin/sh" >  /usr/bin/rebuild-gcj-db; echo "exit 0" >> /usr/bin/rebuild-gcj-db && chmod 0755 /usr/bin/rebuild-gcj-db || :gjdoceclipse-ecjtomcat5-webappstomcat5tomcat5-admin-webappsEB`Konstantin Volckov <wolf@sw.ru> 1.0-1.swsoft- createdvzdummy-jre-fc6/bin/sh1.0-1.swsoft-O2 -march=i386 -mcpu=i686cpiogzip9noarchnoarch-redhat-linuxcpiogzip9? I&W%LSedc4828eac705951cba7dde2ff7290c12fee3f48L{L{t4K xoaXH?4+#schedutilslosetupconfig(util-linux)
libpngconfig(yum-fastestmirror)openssh
audit-libs
libauparse.so.0
libaudit.so.0	chkfontpathgettext-devellibasprintf.so.0libfontencurlgrabbersedconfig(lynx)w(b
D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnu
		ASCII C program textASCII English textASCII textBourne shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedHTML document textISO-8859 textdirectoryexported SGML document textperl script text executable
RRRRRRR	R
RRR
RRRcpiogzip9?0xҰ$!'e05e6f0cf028e011ce35eb591d08c0668ab37457L{l$L{v0
lib/lynx.cfg to /etc/lynx.cfg
- build with slang instead of ncurses
- made default startup file be file:/usr/doc/HTML/index.htmlbuilder16.centos.org 1225137204

n

j

h

3

O

N

4

>

E

A

C

J

H

L

G

D

=

F

<

8

@

6

7

I

5

?

M

9

:

K

B

;

p

q

t



s

v



y









~







x

z



|

{



w



}



u

r

P

Y

V

_

X

Q

T

U

Z

]

R

W

\

[

^

S

`

c

j

l

o

m

g

n

e

d

i

k

f

h

a

b

1

4

7

:

=

@

C

F

I

L

O

R

U

X

[

^

a

d

2cacsdadeetfrhuitjanlptruslsvtrukzhzh2.8.5-28.1.el5_2.12.8.5-28.1.el5_2.1	

lynx-site.cfglynx.cfglynxlynx-2.8.5INSTALLATIONREADMEdocsCHANGES2.3CHANGES2.4CHANGES2.5CHANGES2.6CHANGES2.7CHANGES2.8CMU.announceCRAWL.announceFM.announceIBMPC-charsets.announceOS-390.announceREADME.TRSTREADME.chartransREADME.definesREADME.jpREADME.rootcertsREADME.sslREADME.sslcertsSOCKETSHR.announceTCPWARE.announceVMSWAIS.announcedjgpp.keypdcurses.keyslang.keywin-386.announcelynx.hlplynx_helpLynx_users_guide.htmlabout_lynx.htmlhelp_files.txtkeystrokesalt_edit_help.htmlbashlike_edit_help.htmlbookmark_help.htmlcookie_help.htmldired_help.htmledit_help.htmlenvironments.htmlfollow_help.htmlgopher_types_help.htmlhistory_help.htmlkeystroke_help.htmlmovement_help.htmloption_help.htmlother_help.htmlprint_help.htmlscrolling_help.htmltest_display.htmlvisited_help.htmlxterm_help.htmllynx-dev.htmllynx_help_main.htmllynx_url_support.htmlsamplesblue-background.lssbright-blue.lsscernrules.txtinstalldirs.htmljumpsUnix.htmljumpsVMS.htmlkeepviewerlynx-keymapslynx.comlynx.lsslynxdumpmailcapmailto-form.plmild-colors.lssmime.typestestALT88592.htmlISO_LATIN1_test.htmlREADME.txtTestComment.htmlc1.htmliso8859-1.htmliso88592.htmlkoi8-r.htmlquickbrown.htmlraw8bit.htmlsgml.htmlspaces.htmltabtest.htmlunicode.htmlutf-8-demo.htmllynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.molynx.1.gz/etc//usr/bin//usr/share/doc//usr/share/doc/lynx-2.8.5//usr/share/doc/lynx-2.8.5/docs//usr/share/doc/lynx-2.8.5/lynx_help//usr/share/doc/lynx-2.8.5/lynx_help/keystrokes//usr/share/doc/lynx-2.8.5/samples//usr/share/doc/lynx-2.8.5/test//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-u8

	rhbz#468184)
  - prompt user before executing commands from the lynxcgi: handler,
    even in the advanced user mode
  - mark all lynxcgi: URIs as untrusted in the default lynx.cfg
- add patch to prevent lynx from opening configuration files in the
  current working directory (CVE to be assigned) (rhbz#214205)- rebuild- add buildreq gettext (#193515)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Apply patch to fix CVE-2005-2929 (bug #172973).- rebuilt against new openssl- Rebuild for new openssl.- Apply patch to fix CAN-2005-3120 (bug #170253).- Fixed fix for bug #90302 (bug #152146).- Rebuild for new GCC.- Fixed <option> handling (bug #90302).- Added --enable-locale-charset compilation option, set LOCALE_CHARSET
  on in the config file and removed i18ncfg patch (bug #124849).- 2.8.5rel1.  Fixes bug #139783.- Removed perl dependencies (bug #127423).- rebuilt- No longer need lynx-284-ipv6-salen.patch.
- No longer need lynx2-8-2-telnet.patch.- rebuilt- Updated to dev16, fixing bug #110196.
- No longer need crlf patch.
- Use shipped ja translations.
- Use %find_lang.
- Default config file now sets UTF-8 (bug #110986).- use wide version of ncurses for UTF-8- rebuilt- rebuilt- Fix CRLF issue.- rebuild- _smp_mflags- use openssl pkg-config data, if available- rebuild on all arches- remove menu entry (#69457)- automated rebuild- automated rebuild- Fix build with current toolchain- Update (dev5)- Update (dev3)
- Use "display" as image viewer (#54184)- 2.8.4 release - no need to ship prerelease code...- update to 2.8.4p5 (bugfix release)- Add site-cfg file (#43841)- 2.8.4p2- support newer gettext version- --with-display=ncurses, fixes #37481- Add Czech/Slovak patches from milan.kerslager@spsselib.hiedu.cz (RFE#38334)- dev20
- Add ipv6 patches from Pekka Savola <pekkas@netcore.fi>:
  - enable ipv6, patch for missing sockaddr sa_len
  - buildrequires: slang-devel, zlib-devel
  (Bug #35644)- rebuild in new environment- Fix up more of the i18ncfg patch- 2.8.4dev16
- Fix up the i18ncfg patch - segfaulting on startup is not exactly
  a nice feature.
- Mark locale related files as such
- Mark /etc/lynx.cfg.ja as %lang(ja)
- Add BuildRequires- Add -enable-nls --with-included-gettext
- Add i18ncfg patch
- Add Japanese resources- Update build URL
- Fix help (Bug #18394)
- Replace the "index page link" (pointing to a Mosaic site with thousands
  of dead links) with a link to Google- Add https:// support (#17554)
- Update to dev10- Add Swedish and German translations to desktop file, Bug 15322- automatic rebuild- 2.8.4.dev.4- Fix up location of standard page and help page in lynx.cfg (still
  pointed at /usr/doc instead of /usr/share/doc, Bug #13227)- fixed man page lolcation to be FHS compliant
- use predefined RPM macros wherever possible
- use %makeinstall
- cleaned up files list- 2.8.3rel.1- 2.8.3dev23
- add URL header- wmconfig -> desktop- version 2.8.3dev18
- drop the RFC compliance patch - they seemed to have done theiir own
- pray that ported patches are okay- Add "passive mode ftp" option, activated by PASSIVE:TRUE in /etc/lynx.cfg
- turn on "PASSIVE:TRUE" by default
- deal with the fact that RPM compresses man pages.- Add "view with less" download option- Fix compliance with RFCs describing FTP.
  We can now connect to wu-ftpd >= 2.6.0 based servers.- fix path to help file.
- turn off font switching
- disable args to telnet.- update to 2.8.2- apply some update patches from the lynx folks
- set user's TEMP dir to their home dir to avoid /tmp races- auto rebuild in the new build environment (release 10)- return of wmconfig- create cookie file 0600- update to 2.8.1rel2- build for Raw Hide (slang-1.2.2)- 2.8.1pre9
- strip binaries- updated to lynx2.8.1pre.7.tar.gz- translations modified for de, fr, tr- upgraded to 2.8rel3
- fixed mailto: buffer overflow (used Alan's patch)- updated to 2.8
- added buildroot- updated to 2.7.2
- enabled lynxcgi- updated from 2.6 to 2.7.1
- moved /usr/s@		
config(lynx)webclientlynx@@@@@@@@@@@@JJ@/bin/shconfig(lynx)indexhtmllibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libcrypto.so.6libncursesw.so.5libssl.so.6libz.so.1rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)2.8.5-28.1.el5_2.13.0.4-14.0-14.4.2I`DpD|`CC`C`Cw`CsCrq`CTBIB&7`AݴAz`Al@@q`@@-H?˹>>k>/`>/`>M>===R=<f`<7`;u`;9;g*`;WX`;Kz;6b;`::`:::T`:S:B}`99'9<9l`9k9jG`9@`9f8+`8@`8`88?`8 `7g`7f66k6v`6c`6Cq`68`66A`5S`5N:`544OTomas Hoger <thoger@redhat.com> - 2.8.5-28.1.1Jesse Keating <jkeating@redhat.com> - 2.8.5-28.1Ivana Varekova <varekova@redhat.com> - 2.8.5-28Jesse Keating <jkeating@redhat.com> - 2.8.5-27.2.1Jesse Keating <jkeating@redhat.com> - 2.8.5-27.2Jesse Keating <jkeating@redhat.com>Tim Waugh <twaugh@redhat.com> 2.8.5-27Tomas Mraz <tmraz@redhat.com> 2.8.5-26Tim Waugh <twaugh@redhat.com> 2.8.5-25Tim Waugh <twaugh@redhat.com> 2.8.5-24Tim Waugh <twaugh@redhat.com> 2.8.5-23Tim Waugh <twaugh@redhat.com> 2.8.5-22Tim Waugh <twaugh@redhat.com> 2.8.5-21Tim Waugh <twaugh@redhat.com> 2.8.5-20Tim Waugh <twaugh@redhat.com> 2.8.5-19Tim Waugh <twaugh@redhat.com> 2.8.5-18Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com> 2.8.5-16Elliot Lee <sopwith@redhat.com> 2.8.5-15Tim Waugh <twaugh@redhat.com> 2.8.5-14Adrian Havill <havill@redhat.com> 2.8.5-13Elliot Lee <sopwith@redhat.com>Tim Powers <timp@redhat.com>Tim Waugh <twaugh@redhat.com> 2.8.5-10Nalin Dahyabhai <nalin@redhat.com> 2.8.5-9Elliot Lee <sopwith@redhat.com> 2.8.5-8Nalin Dahyabhai <nalin@redhat.com>Tim Powers <timp@redhat.com>Karsten Hopp <karsten@redhat.de>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 2.8.5-3Bernhard Rosenkraenzer <bero@redhat.com> 2.8.5-2Bernhard Rosenkraenzer <bero@redhat.com> 2.8.5-1Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-17Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-16Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-15Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-14Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-12Bernhard Rosenkraenzer <bero@redhat.com> 2.8.4-11Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Prospector <bugzilla@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Preston Brown <pbrown@redhat.com>Cristian Gafton <gafton@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com> Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Donnie Barnes <djb@redhat.com>- add patch for CVE-2008-4690 (rHs	81c817f8df5473556d67e40feda578aa0f8a60ec1e1e3593c1a744123d4737a98de1980e8847239e170cb4d2f36c983378d505d311b6b216545a1a41e5b164da70015c54450039de46a8dbe4abf5af08d448c2056d3ac63b1a3dffd202d6ca163231d54390d960550a22143df9a39bd5755a189813de7c0359f5c8e5cc4bc162c1f82f9037134c9a5a36ab728fc9c0c31d3de60310eb0f0012603c48526758767f34e15e8a6403eddf4b4b12b3c953eabfb532b97ca2867eb9aa098e7b131f6e3d7b0faf012b2f062ebac4622f66dc9ffdba4aa9e4286348248b051ee73521f3732bb61b57def0124cd1b8c82c392cc444c72a9142fff47242a020389ce5c6efe4c6e9585e3bf18cb5338e027f860c94789c93f58d75c3b12fe7fe2f8a0346be6f0885ee093168d36f0f9d6923c4cf03894a63731ca1a9b449302df3fd6473bd7bc598c839b3d7828fba2a25cf6a51058370457a6313b9ff2905952355c6e75400098472d8b2bfcc8ae21df7fed34bfd34c4acb0b235462d91668d21efe40c0a04d3b017f2cb0f2ac04753a746db77b809245b638e38347b35163bcb9ffb835874652167c2d34bf6728c16ee190ed82a77c6a6b009ce1e3a693992006b1f240f33ea8e19ec3f621087d6bcaeb5bb13849c6545a52191714fc6344b46fd34242c42bbff59a287301deb9b177a23817d3714e4783ab4d8bd15a8702a0d7220b0e45aaa07b9f34062943aed6526e415686d258a6b05470349d9406916c5882cc216fc79a0bb9be43eabc58929c5a4d3c40607c7c5831afe3c4544c79fe666571e8318959ac65efd75b714e5ee55430e88ef2725349b17a1bca9c86dc2a0ab12b435b94613dacae4b122e6fa3da14ce2211c93721fb2327970c9ff84612a414fc659f9e38e882e6804e387204bcc4ef4196e60bdf1ddd2107a3ccf568a913f60773d0591601c28f19f37e6520790c5cc54a1e467fa15023fff47de1cd8d324cc7f8961b87ca5f43bbc9f677fec369ff31605167a5db8ab962ad3536565ea9c974cb1164df240ea611e5263935032e46a31e1147e6356d5d4210f5aa8c1c07880fee0ec90227ddaf8749c3bea01b1da6d206432125330760a307d3922b86de3f76a0c990b42e584009a1f600f4062b5c09e59f2c7423d471fbe9f98ca1d65c6b6777fc7c9518fbac3e4c8dd01733975b96651bc636357351bac4fe554ba840aaf77efbec01dde60b48bcb7678e040e4181a6287775f7bbb83e5715b527908fe870d4155a826f3429e08ee371ee4488f296b381bfac6c033d2bcd26ccc73d1a1d3e9a200d31e9a1132461cd6c396f18ab1f1c348899c8fdaa5a0c4dba9c5b06bbbc840fc86a501809bae79e5f8c1c2ae4a4292de63c62cd84898f14a44908503c6fd478c1a4f186cc4b21783998cd865ab1fc82c1fafa2df645d41919e7dc6e144e855932c8b0c66e5d9a0963f1c5d764f140997d0c2e5ab7356dca3a69f280baa673d3c738fe26d1c0a242841905739987ee36534bc0ec4f322cee80aee28c689f4dacb7228rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlynx-2.8.5-28.1.el5_2.1.src.rpmqEU?Td
		4,0HLU\	`voTo	2o
oo[o
ooooE(t8|K9K:+;KF;G;oH=oI?\oX?Y?\@$o]Ao^GbKdKeKfKkKlKtKouMovOPwPoxRHoyT{T<odTeTfTTT
TUUoU|gUhUClynx2.8.528.1.el5_2.1A text-based Web browser.Lynx is a text-based Web browser. Lynx does not display any images,
but it does support frames, tables, and most other HTML tags. One
advantage Lynx has over graphical browsers is speed; Lynx starts and
exits quickly and swiftly displays webpages.Ibuilder16.centos.orgF7CentOS-5CentOSGPLApplications/Internethttp://lynx.isc.org/linuxi386B#DT1Fl@wZHc
4$tH
Xz
q&h	W
T&_RaJ2p
H?ruBf^
V$7:y:2=4y	{ZQ'\.ҕJE\u.܁A큤A큤A큤A큤A큤큤큤A큤IIII@
@!@#6s><6s><6s><4^4^7I3;3;6s><6s><@!8Wuv6s><?]8C?]@ʂ?]6s><3;3;6M7 #6M7%@
@@@ʂ@ʂ@<v<v<v<v<v<v@!<v<v<v<v<v<v@<v<v<v<v<v<v@ʂ@=7;G8)7x8Wuv3;;8Wuv3;:";t=j=j9rz}6) =
43;3;3;844=ذ=ذ5g=ذ73;=ذ=ذIIIIIIIIIIIIIIIIIII473170512847b1c1ead51c80d2ad200a2112f34cab1e10b5e8ac7e51c3fac9916bb6fda0fafd116d0d34d145a64857b224c23aaf1509ddb8820377f77650419d24b3c448ef05b32c7c45279b8172cd1b0e1b59853db8c3d53ea2e2fbc79112d78b168e56d5e42eddb1065dc1fcf0de650c774c1c43be90dd78bf63f731b0c6f92fb142080f3c2609ade3c40e9a90ec49a51bb4fff31946282d0cd52667904c6ce5fab1d017f8f6fc906c31ce17bc478741990577cc5d3526fb3acf2ce51b1837f3e73dc7ffca063f5f17148f3ccdea517e9c81e5603472cba66d66a3e18f3a0eb512fac7e57804030c33d752cfc34de7bbc38d2f43586c67ab3f6b0b8eb32765580c99adeb1260ef5513946a0b3dd26e8f5a57d29a6ca830998906b74d1b5f07a677396dd1c3d29c37ee54c66523711409a8367bbe7d129b77790ad500c581aae8d371a700ee42768ca67ff821bcde3c74b82d175b13b36febec4f1b9d7fa86c8863df6804c3dad0a7c63d415a0f93b47f08779b14d812bef1cf0a82b9892cf57b92c70b47f25f936eefb06da09f90cd622b0360a6d648dd8f8fe8a5f3291a3611e47249c9c902d6775d3c110c5d30b46cb66f692bd040b5f9513d05afb412bb950b049ccce65a90558fc7a3a122d31f03120caa19a64a56419b558404b8fd07c5adcc2fc7e41264fa4c31da1d3ad6b6ea3f6949e7faced1d09d241b9559af1027e3bb50126fee8f1e014fe8b04f035e8f34fb6f4f2040f5f4cbd3eb261108e08b613afe4803f55134d943784dd4d3ca8c5085fa2cdea33850f9bdfd3b8d0aef9fbcf86ca327c7083989ef33c6zve\KB1({raXG>-$










w
n
]
T
C
:
)
 


sjYP?6%ofUL;*









}
t
c
Z
I
@
/
&


										y	p	_	V	E	<	+	"			ul[J90zi`OF5,	~m\K:)}dSJ90zi`OF5,ve\KB1({raXG>GݴvS#\΢D~mc)֜D9	"k?F艘'(i]s7>:HnM:}oy|O
?9haژ$Tn7^'esX
r5UdgJ}2g?eG@?P1+Da-~<hqs}2,cyzY(f_qC(y'N,72S1.6%{ZR$
K)Io0^};#O	6$7q!NP2v cn/Pbס(.ҮnsPg^Lpf)BJiZXKg8#Џx"r_B"x:N	\Uԁ
0۶
zyMjb>'R4fcoSڰICQE01jc2ߠLkύ|qs	ܬ.#F7Pf#}OȄPc&ƜslTُ	B~\|$hV'OhbL bABh+5
3k[FQC'#܁SyLq'#OQ	g
b-xjHn`Ba@h>D
oSTYh`T:Ykjzmp#`*"}կM-X(YuTD,
H'h|h*	ն|ϿUJ$z5

UXJ.\
~E3&MYa
U#sU:'lWAͱwH
j@B; h>FK*QRs)Q^^JN	OՐmj	>0q~/	,]k@mdB;XcS
Xͣ]n|Mk

q]_a)]zF=sj^-H^|?\u\,.b#JXBm~'/kbVsiV;j	-EQ˖R*zLf %STQN!F^cbcOMz'ݒ;KkLW_ Sha>:HnM:}oy|O
?9haژ$Tn-~<hqs}2,cyzY(f_qC(y'N,72S1.6$
K)Io0^};#O	6$7q!NP2g^Lpf)BJiZXKg8#Џx"N	\Uԁ
0۶
zyMjb>'R4fcoS	ܬ.#F7Pc&ƜslT\|$hV'OhbL bABh
b-xjHnh`T:Ykjzmp#`*$z5 5%8T@j4Ԏ!eTQ^?oS`,v
`&Ԣ"l6.< +*NH*G
c;~&n"
(Ɖr(kf٠?]vO	jd]A}DU,`W5OT
w_s9ufQcc^=GeƶwQ\0v
0}9"mjBW;g6z]Pm 5FO^uUC'%4M>ʼn)ŤA5F-f!
Ӱ?zc)#UT	:uñ//Fo7WLѸ,9,D*4|~	{n={0|YKb//C`U
"=uZ&a:HQ4CxM$4oO @&#'PoOO^ZUǣ"Í/CXlg?k'e
/B<&	I$:	ݸwvPAkm
4EHW7[̈]Dh>Z#&6}:rp!FTL21d'a-_1ӑmO
5԰-G.Iqtb*RC)%㭁;y\(9 KzqN`4|i~rtŁOW]ps#KFܩ<N'&7.b1x!$x ӛ?
iofUL;2!|kbQH7.









x
g
^
M
D
3
*


}tcZI@/&yp_VE<+"









u
l
[
R
A
8
'



										q	h	W	N	=	4	#					~mdSJ90kbQH7.xg^MD3*}tcRA8'
zi`OF5,ve\KB1({raXG>/3<>k0~L. pȹO*(uWI:y_)GY&ԏ"{yg>"Oi!kpUJ .;}V<6
{VX Gp$a9~&,E{a3=N(Ndh^dI)?/!)+[0nYqW03j/]LHrz?Zn,L&&6T^~3ycӏ5io8I)lS|h9kW/OFypF닏n"פ(ClAScp u\P~Q)cAZFAݪ|NJbE\YhW.NYkLDxER<I!uY+YB[(I'9*q y	
+%?G46rEXo2<IP_S?fd`p~R.GH~-y_o=5m6*dL]ei[݋)P2#3i(d޿&,PD4>>%G2ݪ&br#Wܦ"(5}r"qHҒch:@/ lNLP|,J>J$i##
sVMV-T?vt
Bz:4טsXU;G&DFLufp'u0j&ꄹ$(f~r~BM[%+!qcyxNntJY9ϿO]s$s̘[è+_y70N!k,[o`ckbXx}j4}g
	n6J6^v
s,Wnp瑎(@Њi]-.f!
pٺe~+4^5K~<qO+?oiy$\m]`v֏t
ZuM
.s:8G
XH]n'dĻYUBx
U@Y
UDaAEÐK=Te6?ƄiJ!fRN˚3Fp`i>ՅE;Mp'#/{Bـ9Lda@ׂ<)WF<'=$Qn2q'i|w<׶jpO`:v;eƴ=.7-46̘Qkn"3BwHC?nYqW03j/]LHrz?ZnT^~3ycӏ5io8I)lW/OFypF닏n"פ(ClAScp ubE\YhW<I!uY+YB[Xo2<IP&,PD4>>"qHҒch:@/J$i##
sVMV-T?vt
B[o`ckbXx}j
ҩ$
2Y|FArPsU\ޔ<5sW8w+^9vO1?e]*aymm
$(AW9~e4gy®JBcfڥ۩Űk@[}t;m d2SZV!Zx"Y@aRcP2j1~cX*SeeꜗLMV?G$a|S.h KNn`Q"=L!rJ@b:e&hm%kI:ؽp*
r ZHY0z#}7xCc84{5;˟Xte!@rز̊K4Ĭ>9ׂ*%jQpE;	1hoi#Jc9X^;3x3^dKKS꿵217LZ6r=*5D=G7'P,ޣ8P;
 ŭ/dL1:ֶw
,X`Uj=n	wLCxc1Y=>Ǒ$H,|E'r!L~Qɑ46:[OKFq{
/8i8Ft.jb (-y$$=
uURmU-Xb	e'm;2CTPTG;*G4?p
y{F.:>3YO$)\JDH~yޗ/d4[5ʼXa&,6eRэh^&,6e$/var/lib/rpmrebuilddb.5717/Filemd5s2pI) d5stPsjA8
6a86f2020f41b1d148aa2fc89ba2a6ec22764a08
544ab2ba7e9b99e402e75da9b2067e887c1873bc	eff02849d1d2902b68916754360ccd7df9262e8b1b84499663165606e4049550420b781f4661be757ac04a77fd831e604eaf7c92978cd5e2a51fbdbdde81d824c678227d555651a25d1c9fe2f33db60fux\(@4P,l`pdtx4h\, 



h
\
4
(

4(tTH lH<dP,|XL(pL8h\

8,

h
T
0

					|	T	@			\H/usr/lib/yum-plugins//etc/yum/pluginconf.d//usr/share/doc/openssh-4.3p2//usr/libexec/openssh/
/usr/libexec/	/etc/ssh/
/lib/	/usr/share/man/man8/	
/usr/sbin//usr/share/man/man3/
/usr/share/gettext/projects/TP/ /usr/share/gettext/projects/KDE/"/usr/share/gettext/projects/GNOME/
/usr/share/gettext/projects/	/usr/share/gettext/7/usr/share/doc/gettext-devel-0.17/javadoc2/gnu/gettext///usr/share/doc/gettext-devel-0.17/javadoc2/gnu/+/usr/share/doc/gettext-devel-0.17/javadoc2/"/usr/share/doc/gettext-devel-0.17//usr/share/aclocal/
/usr/include/ /usr/share/doc/libfontenc-1.0.2/
	/usr/lib/'/usr/share/doc/python-urlgrabber-3.1.0/,/usr/lib/python2.4/site-packages/urlgrabber/!/usr/share/locale/sr/LC_MESSAGES/!/usr/share/locale/sk/LC_MESSAGES/!/usr/share/locale/ro/LC_MESSAGES/!/usr/share/locale/pl/LC_MESSAGES/!/usr/share/locale/ko/LC_MESSAGES/!/usr/share/locale/id/LC_MESSAGES/!/usr/share/locale/hr/LC_MESSAGES/!/usr/share/locale/he/LC_MESSAGES/!/usr/share/locale/gl/LC_MESSAGES/!/usr/share/locale/ga/LC_MESSAGES/
!/usr/share/locale/fi/LC_MESSAGES/!/usr/share/locale/es/LC_MESSAGES/
!/usr/share/locale/eo/LC_MESSAGES/	!/usr/share/locale/el/LC_MESSAGES/!/usr/share/locale/af/LC_MESSAGES//usr/share/info//usr/share/doc/sed-4.1.5//bin/ #/usr/share/man/man1/$/usr/share/locale/zh_TW/LC_MESSAGES/"$/usr/share/locale/zh_CN/LC_MESSAGES/!/usr/share/locale/uk/LC_MESSAGES/!!/usr/share/locale/tr/LC_MESSAGES/ !/usr/share/locale/sv/LC_MESSAGES/!/usr/share/locale/sl/LC_MESSAGES/!/usr/share/locale/ru/LC_MESSAGES/$/usr/share/locale/pt_BR/LC_MESSAGES/!/usr/share/locale/nl/LC_MESSAGES/!/usr/share/locale/ja/LC_MESSAGES/!/usr/share/locale/it/LC_MESSAGES/!/usr/share/locale/hu/LC_MESSAGES/!/usr/share/locale/fr/LC_MESSAGES/
!/usr/share/locale/et/LC_MESSAGES/!/usr/share/locale/de/LC_MESSAGES/!/usr/share/locale/da/LC_MESSAGES/
!/usr/share/locale/cs/LC_MESSAGES/	!/usr/share/locale/ca/LC_MESSAGES//usr/share/doc/lynx-2.8.5/test/"/usr/share/doc/lynx-2.8.5/samples///usr/share/doc/lynx-2.8.5/lynx_help/keystrokes/$/usr/share/doc/lynx-2.8.5/lynx_help//usr/share/doc/lynx-2.8.5/docs//usr/share/doc/lynx-2.8.5/ 	/usr/bin/
/etc/0/usr/share/doc/python-elementtree-1.2.6/samples/-/usr/share/doc/python-elementtree-1.2.6/docs/(/usr/share/doc/python-elementtree-1.2.6/@
/usr/share/doc/-/usr/lib/python2.4/site-packages/elementt!/usr/share/locale/af/LC_MESSAGES//si/ b1		&,5 &,5$/var/lib/rpmrebuilddb.5717/DirnamesxS `Pmes
T v@]\T
R=xc2&









|
s
d
[
?
6
2
)



tkWN:1i`PG;2







s
j
]
T
libuuid.so.1libutil.so.1(GLIBC_2.0)libutempter.so.0(UTEMPTER_1.1)libutempter.so.0libtermcap.so.2libpam_misc.so.0(LIBPAM_MISC_1.0)libpam.so.0(LIBPAM_1.0)libpam.so.0libncurses.so.5/etc/pam.d/system-auth

libpng12.so.0
	libpng.so.3
libm.so.6(GLIBC_2.0)yum libselinuxlibresolv.so.2(GLIBC_2.2)libresolv.so.2(GLIBC_2.0)libnss3.so(NSS_3.6)libnss3.so(NSS_3.4)libnss3.so(NSS_3.2)libnsl.so.1libk5crypto.so.3libgssapi_krb5.so.2libc.so.6(GLIBC_2.1.1)config(openssh)
config(audit-libs)	xfslibstdc++.so.6(GLIBCXX_3.4)libstdc++.so.6libgettextsrc-0.17.solibgettextpo.so.0libgcc_s.so.1(GCC_3.0)libgcc_s.so.1gettextlibfontenc.so.1glibclibssl.so.6

		
libc.so.6(GLIBC_2.2)indexhtmlpython-abipython(abi)libpthread.so.0libexpat.so.0	
	

libc.so.6(GLIBC_2.4)

libc.so.6(GLIBC_2.1.3)
	

libc.so.6(GLIBC_2.0)d v@]\	=.y8#





}
j
Y
I
@
7
.

tk_VI8*	neXOD;'










m
d
Q
H
:
1
 


					%udev pamlibselinux.so.1libpam_misc.so.0	libblkid.so.1config(util-linux)config(yum-fastestmirror)#openssl!libutil.so.1libresolv.so.2libplc4.solibnss3.so(NSS_3.9.2)libnss3.so(NSS_3.9)libnss3.so(NSS_3.3)libnss3.solibkrb5.so.3libfipscheck.so.1libcrypt.so.1
libcom_err.so.2initscriptsaudit-libs/sbin/nologin
libauparse.so.0
libaudit.so.0	libpopt.so.0	/sbin/pidoflibstdc++.so.6(CXXABI_1.3)
libm.so.6libgettextlib-0.17.solibasprintf.so.0infocvs

/sbin/ldconfigm2crypto/usr/bin/python/sbin/install-info
	"
libz.so.1libncursesw.so.5
libcrypto.so.6	


libc.so.6(GLIBC_2.3)	
libc.so.6(GLIBC_2.1)config(lynx)/bin/sh
	

&
$rtld(GNU_HASH)		

libc.so.6(GLIBC_2.3.4)		


libc.so.6~xL*yl[N=0'{rg^QH90










~
k
b
Q
H
6
-


	

|ofbYQ8*!|snUF=,#












w
n
e
\
S
J
4
+
'

	

									u	r	i	c	Z	L	C	1	(	!		
		ri`WOF=4,#yneWN=4#~tk_VKB3*{rh_VM7.%mdRI<3*!HprojectsGmsgunfmt.tclFjavaversion.class?serialized-form.html>packages.html8package-tree.html7package-summary.html5GettextResource.html3gnu1allclasses-frame.html0javadoc2.bindtextdomain.3.html*xsize.m4)wint_t.m4&uintmax_t.m4%stdint_h.m4"printf-posix.m4!po.m4 nls.m4lock.m4inttypes_h.m4intmax.m4intl.m4iconv.m4glibc2.m4gettext.m4codeset.m4
libgettextsrc.so	libgettextpo.alibasprintf.so.0.0.0libasprintf.so.0libasprintf.solibfontenc-1.0.2TODO,ChangeLogpython-urlgrabber-3.1.0sslfactory.pyosslfactory.pycprogress.pymirror.py
keepalive.pyokeepalive.pycgrabber.pybyterange.pyurlgrabberrootflags.8.gzpartx.8.gzmkswap.8.gzmkfs.8.gzfdisk.8.gztailf.1.gzlogger.1.gzkill.1.gz~ddate.1.gzychsh.1.gzvcal.1.gzuarch.1.gz_getopt-test.tcsh^getopt-test.bash[README.poeiglQREADME.calMvipwLvigrKvidmodeAtailf?setsid<renice5isosize,ddate#cal!swapoff sfdisknologinfsfreezedelpartblockdev60-raw.rules&chsh	umount7logger6killdmesgarch

libpng.txt
README.nssmoduli
libaudit.so.0.0.0
libaudit.so.0XindexSTPMRWtriggerJOTYteam-addressIGNOMEGmsgunfmt.tcl>packages.html7package-summary.html3gnu1allclasses-frame.html0javadoc2*xsize.m4)wint_t.m4&uintmax_t.m4%stdint_h.m4"printf-posix.m4!po.m4inttypes_h.m4intmax.m4iconv.m4glibc2.m4
libgettextsrc.solibasprintf.so
TODOprogress.pymirror.py
keepalive.pyokeepalive.pycgrabber.pybyterange.pyurlgrabber*sed.1.gz	sed.info-2.gzOAUTHORSsedVraw8bit.htmlUquickbrown.htmlRiso8859-1.htmlPTestComment.htmlOREADME.txtMALT88592.htmlLtestDlynx-keymapsBjumpsVMS.html6test_display.html2option_help.html1movement_help.html-follow_help.html%keystrokes"Lynx_users_guide.htmlslang.keyREADME.definesOS-390.announceIBMPC-charsets.announceCRAWL.announce
CMU.announce	CHANGES2.5INSTALLATION4pythondoc-elementtree.XMLTreeBuilder.html0pythondoc-elementtree.SgmlopXMLTreeBuilder.html,pythondoc-elementtree.ElementInclude.html(benchmark.py"__init__.pyo!__init__.pycTidyTools.pySimpleXMLTreeBuilder.pyoSimpleXMLTreeBuilder.pycElementPath.pyelementtree]xLrKBwne\D;*!









z
q
h
_
P
G
<
3





{rjYI@,#
~sj_VH?2)








~
u
m
d
Q
H
:
1
$

	

										p	g	_	V	M	D	9	0	 			sj\SKB=,&xoi`VM@7*!B8/#|skbUL@7+"
LC4+zqfMC*wg^etextdomain.3.gzdngettext.3.gzcgettext.3.gzbdngettext.3.gzadgettext.3.gz]bind_textdomain_codeset.3.gz\gettextize.1.gz[autopoint.1.gzLQVteams.urlKPUteams.htmlEgettext.hDconfig.rpathCABOUT-NLSBtextdomain.3.htmlAngettext.3.html@stylesheet.css=package-list<overview-tree.html:index-all.html9help-doc.html6package-frame.html4gettext2deprecated-list.html/gettext.3.httunelp.8.gzswapon.8.gzraw.8.gzlosetup.8.gzfloppy.8.gzcytune.8.gzagetty.8.gzaddpart.8.gzul.1.gzrev.1.gzreadprofile.1.gzmore.1.gzmcookie.1.gzlogin.1.gzionice.1.gzgetopt.1.gzflock.1.gz{colcrt.1.gzxchrt.1.gzbcdefghijklmnopqrstutil-linux.moaipc.info.gzXREADME.modems-with-agettyUREADME.gettyTREADME.fdiskIrootflagsDwriteCwhereis>script8look4ipcs3ipcrm1hexdump)colrmpartxmkswapmkfs.cramfsmkfsfdisk
$chfntaskset
libpng-1.2.10fastestmirror.pyofastestmirror.pycfastestmirror.confWARNING.RNGREADME.tunREADME.smartcardREADME.privsepREADME.platformREADME.dns
OVERVIEW	LICENCE	chkfontpath.8.gzetextdomain.3.gzcgettext.3.gzadgettext.3.gz]bind_textdomain_codeset.3.gzCABOUT-NLSBtextdomain.3.html=package-list9help-doc.html6package-frame.html4gettext2deprecated-list.html/gettext.3.html-bind_textdomain_codeset.3.html'visibility.m4$size_max.m4#progtest.m4longlong.m4lcmessage.m4intlmacosx.m4intdiv0.m4glibc21.m4libgettextpo.so.0.4.0libgettextpo.so.0libgettextlib.sogettextizeautopointINSTALLCOPYINGlibfontenc.so.1.0.0libfontenc.so.1
LICENSEkeepalive.pysed.info-1.gzPNEWSBUGSnlynx.1.gz[utf-8-demo.htmlTkoi8-r.htmlQc1.htmlNISO_LATIN1_test.htmlKmime.typesImailto-form.plGlynxdumpCkeepviewer>bright-blue.lss=blue-background.lss8xterm_help.html7visited_help.html3other_help.html*dired_help.html)cookie_help.html'bashlike_edit_help.html lynx.hlpVMSWAIS.announceTCPWARE.announceREADME.rootcertsCHANGES2.8CHANGES2.4lynx-site.cfg5<samples3pythondoc-elementtree.TidyTools.html-pythondoc-elementtree.ElementPath.html+;index.html)docs%CHANGES-cElementTree __init__.pySimpleXMLTreeBuilder.py
nxLa&,c:Xэh^&,c:X,/var/lib/rpmrebuilddb.5717/BasenamesHLS	/ 0L LCP	mentInclude.htmlpythondoc-elementtree.ElementPath.htmlpythondoc-elementtree.ElementTree.htmlpythondoc-elementtree.HTMLTreeBuilder.htmlpythondoc-elementtree.SgmlopXMLTreeBuilder.htmlpythondoc-elementtree.SimpleXMLTreeBuilder.htmlpythondoc-elementtree.SimpleXMLWriter.htmlpythondoc-elementtree.TidyTools.htmlpythondoc-elementtree.XMLTreeBuilder.htmlsamplessimple-ns.xmlsimple.xml/usr/lib/python2.4/site-packages//usr/lib/python2.4/site-packages/elementtree//usr/share/doc//usr/share/doc/python-elementtree-1.2.6//usr/share/doc/python-elementtree-1.2.6/docs//usr/share/doc/python-elementtree-1.2.6/samples/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnu				ASCII C program text, with CRLF line terminatorsASCII C++ program text, with CRLF line terminatorsASCII English textASCII English text, with CRLF line terminatorsASCII Java program text, with CRLF line terminatorsASCII text, with CRLF line terminatorsELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippedHTML document textdirectory

 !"#$%&'()*+
PRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRcpiogzip9?@g$SyݦAde81d824c678227d555651a25d1c9fe2f33db60fL{>L{BXrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-elementtree-1.2.6-5.src.rpmcElementTree.sopython-elementtree@@@@@@@@JJ@libc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libexpat.so.0libpthread.so.0python(abi)python-abirpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)2.42.43.0.4-14.0-14.4.2DDDpCC`C`BQBK!`BIB9B0`B*+Jeremy Katz <katzj@redhat.com> - 1.2.6-5Jesse Keating <jkeating@redhat.com> - 1.2.6-4.2.2Jesse Keating <jkeating@redhat.com> - 1.2.6-4.2.1Jesse Keating <jkeating@redhat.com> - 1.2.6-4.2Jesse Keating <jkeating@redhat.com>Jeremy Katz <katzj@redhat.com> - 1.2.6-4Konstantin Ryabitsev <icon@linux.duke.edu> - 1.2.6-3Konstantin Ryabitsev <icon@linux.duke.edu> - 1.2.6-2Konstantin Ryabitsev <icon@linux.duke.edu> - 1.2.6-1Konstantin Ryabitsev <icon@linux.duke.edu> - 1.2.5-1Konstantin Ryabitsev <icon@linux.duke.edu> - 1.2.5-1- don't ghost pyo files (#205446)
- upstream bugfix release- rebuild- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- rebuild for core
- use %setup -q -a 1 instead of unzipping source1- Use python_sitearch for the C library.- Use python_sitelib
- Own the elementtree dir in site-packages
- BuildRequire python-devel
- Do not namely require expat
- Do not use INSTALLED_FILES (safer)
- Use ghosting for .pyo- Version 1.2.6 of ElementTree.- Rename as python-elementtree.- Initial RPM release.builder5.centos.org 1168121196\GM\G\G'\G2\G=\G%\G0\G;\G\G*\G5\G$\G/\G:\G#\G.\G9\G\G)\G4\G&\G1\G<\G"\G-\G8\G \G+\G6\G!\G,\G7\G(\G3\G>\GO\Ga\Gb\G_\G`\Gc\GP\GZ\GX\GT\GR\GS\G[\GV\GW\GU\GY\GQ\G\\G]\G^1.2.6-5cElementTree.soelementtreeElementInclude.pyElementInclude.pycElementInclude.pyoElementPath.pyElementPath.pycElementPath.pyoElementTree.pyElementTree.pycElementTree.pyoHTMLTreeBuilder.pyHTMLTreeBuilder.pycHTMLTreeBuilder.pyoSgmlopXMLTreeBuilder.pySgmlopXMLTreeBuilder.pycSgmlopXMLTreeBuilder.pyoSimpleXMLTreeBuilder.pySimpleXMLTreeBuilder.pycSimpleXMLTreeBuilder.pyoSimpleXMLWriter.pySimpleXMLWriter.pycSimpleXMLWriter.pyoTidyHTMLTreeBuilder.pyTidyHTMLTreeBuilder.pycTidyHTMLTreeBuilder.pyoTidyTools.pyTidyTools.pycTidyTools.pyoXMLTreeBuilder.pyXMLTreeBuilder.pycXMLTreeBuilder.pyo__init__.py__init__.pyc__init__.pyopython-elementtree-1.2.6CHANGESCHANGES-cElementTreeREADMEREADME-cElementTreebenchmark.pydocseffbot.cssindex.htmlpythondoc-elementtree.EleA`D%0?$d		8|	88	@8
88H8
8`8
x88(89:/F[G|8H\8I<8XtY|\8]h8^	bdefklt8u8v |
w!8x"8y#,{$T8d$e$f$$$
$$$8%$g%(h%,Cpython-elementtree1.2.65Fast XML parser and writerThe Element type is a simple but flexible container object, designed
to store hierarchical data structures, such as simplified XML
infosets, in memory. The element type can be described as a cross
between a Python list and a Python dictionary.

This package also includes the C implementation, cElementTree-1.0.5-20051216.Ebuilder5.centos.orgCentOSPSFDevelopment/Librarieshttp://effbot.org/zone/element-index.htmlinuxi386yy[X,xEE

"@#mnVJnA큤A큤A큤A큤ErErAhErErAhErErB9ErEsB8VErEsAhErEsAhErEsB&VErEsB$ErEsAhErEsB$*ErEsAhErEsEsB9EpB9EpAhEpAhB&aB9B9B9B9B9B9B9B9B9EpAhAh01de972ff005e08e6405e9345b35cabcc52f8492edd75eb11e858addd9ce9f6b84d5d8469d4ea2ab53c87b5776a79ca784d5d8469d4ea2ab53c87b5776a79ca74b19897445862edd9db3cbbbcf58b4494f24e1295c4a178844e50c489c7e96794f24e1295c4a178844e50c489c7e96796f5de929965e5366356201d9c8c6b3ded7905bab00da277a682cfaaf7ec0a225f62b59ea33599e8e6516ea9eeb0d66f19506cff52124abc2defa7820a7d39b3feef8aa7f79927b462e3ad8173ebc3359eef8aa7f79927b462e3ad8173ebc3359f497da02b84e0c2726df370c2e623178509754f3478b3b2a47b9d5db34843f70509754f3478b3b2a47b9d5db34843f70e4ef1bb5afc93bfb321796ad86430e54cd73237f4b8a834685f3dca9d13c90f1cd73237f4b8a834685f3dca9d13c90f1e93da740a026e1eccf834d5fba28cb6d5b648e6536ddf9ceae7b51d2d2ff3faa7bbc867c53ff1a3b1e0040b7fbf57980f072e09c74c581d9d4ca4fa7d4575d70b56b28c1789da1f2887a9b8c1c5f0cabb56b28c1789da1f2887a9b8c1c5f0cab4a1c3da4aa1d47738d83b6f22ef6ecabf879316d3a1cc261ddd8693bff37af41f879316d3a1cc261ddd8693bff37af41d858c5d66209f3f4cb652792aacf0c6d047192f4a8e14d910daaf69da7f6710d21aede9ca6b72544b8bc85597ee7ecd14b7a1c841a92714e6034c97c69d97edc21781fa1085e22aa0a2b67cef6804d8421781fa1085e22aa0a2b67cef6804d84cb053d1e0d75c40c55526dc0552dd8c3e3ad81913beae81793795c102839a6148893f28c9022837c417e965ff5c103aecb10cd7284c53bedf744875ea1b48767e94df06c8f3de4b69a23990bb30696230210e592165243ab9e19fae98c1529a6aa0968b58252e94f99e68ea557add229560e0d181e58a99fc06a31a4be5f6f4b472e0c14ebdb49bab5c3717462a5c5da6a17622015b7bdac2883dd0e2d79fc24948338e311b29d69380bee1646ff74f9659f74473a89933e8bce76cd33e846e6d391c46d979e4f0aa71002350fcfd4b0919fa8310264c2d107e6278e612d5fc6f31a09218aa3f2ddfa94a480ff9340cd0036cc3ad65b4f4bce46717bd0ef0d9f107d3a72b870214693ce54194caaf7b0e65baf86cc885d44683e5a822326e790PsjA8,T
эh^a9d11387aa04a27b2c224a751cc2be2ed04f6a1b445050563779d41510b4a1ab71bee97e11e59da1eb0bfb1d2815fc9603c58cd6f2db267fba27af6700a7efceb00797d0f2b28eb083a79e597997a820edc4828eac705951cba7dde2ff7290c12fee3f48e05e6f0cf028e011ce35eb591d08c0668ab37457376ea3c3ef7d15deaaf00387fb61a28e1d4b0a3aDPa&,T

эh^&,T
,/var/lib/rpmrebuilddb.5717/Sha1header 8"2 Ht~mdSJ90эh^
=/]+]7N'dodf	aȅ"+5:t3a(dbIyOj0\Jm4'&0I&W%LSxҰ$!'SyݦA@}ba&,^UK
эh^&,^UK$/var/lib/rpmrebuilddb.5717/Sigmd5`@"82 H85G
\h\p&,
ε
 
(O
{XO	:sNsN {L-6b1		&,
ε
 &,
ε
,/var/lib/rpmrebuilddb.5717/Installtid@"0
 ph`@
ht\PhT8$

D0
2:1.2.10-17.el5_81.1.16-21.el5.centos4.3p2-82.el5

	1.8-2.el5	
1.10.1-1.1
0.17-1.el5
1.0.2-2.2.el53.1.0-6.el54.1.5-8.el51.0-1.swsoft2.8.5-28.1.el5_2.11.2.6-5X





2.0-1.ce.swsoft2.6.18'h`H
b1		
&,:/>	 
&,:/>	,/var/lib/rpmrebuilddb.5717/Provideversion@"0W
 nH)!
xh\

<0



PD

`l  1.27.75.204.3p2-82.el51.0.8
	1.8-2.el5
0.17-1.el50.16-52.3.3-282.8.5-28.1.el5_2.12.4	

	

		

			H2`	3.0	1.1.16-21.el5.centos#
0.9.8e	 1.27.75.204.3p2-82.el51.0.8
	1.8-2.el5
0.17-1.el50.16-52.3.3-282.8.5-28.1.el5_2.12.4h	
	

$
3.0.4-1h
		
%

4.0-13.0.3-1,H)b1		&,޽̹u &,޽̹u,/var/lib/rpmrebuilddb.5717/Requireversion )@"0 )(n
xK$O~neSJ:1{rlcXOutil-linuxmount
libpng12.so.0(PNG12_0)
libpng12.so.0

libpng.so.3yum-fastestmirrorconfig(openssh)
config(audit-libs)libgettextpo.so.0libfontenc.so.1python-urlgrabbervzdummy-jre-el5lynxwebclientpython-elementtreecElementTree.sovzdummy-kernel-el5kernelyTKa&,t0"эh^&,t0,/var/lib/rpmrebuilddb.5717/ProvidenameXK0% @K0K
e@]a
&,w{5\эh^
&,w{5,/var/lib/rpmrebuilddb.5717/Requirename]8"% \\
tx
OsjXO	&,:#эh^Development/ToolsApplications/TextApplications/Internet
Development/LibrariesApplications/Systemxa	&,:#эh^	&,:#$/var/lib/rpmrebuilddb.5717/GroupP8"86 8(Wtk`W,olkэh^util-linuxyum-fastestmirrorpython-urlgrabbervzdummy-jre-el5lynxpython-elementtreevzdummy-kernel-el5a&,olkэh^&,olk$/var/lib/rpmrebuilddb.5717/NameHC86 p`z-?id	%	Fhlx|	U(k8t9:)BsXYZ[bd2e7f<k>lEd]ebfg|
ghCvzdummy-kernel-el52.01.ce.swsoftDummy package to provides kernelDummy package to provides kernelF(wolf.sw.ruSWsoftGPLApplications/Systemlinuxnoarchvzdummy-kernel-el5-2.0-1.ce.swsoft.src.rpmkernelvzdummy-kernel-el5JJJrpmlib(VersionedDependencies)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)3.0.3-14.0-13.0.4-14.4.2D3\C`Cp>CeEvgeny Sokolov <evg@sw.ru> 1.0-3.swsoftEvgeny Sokolov <evg@sw.ru> 1.0-2.swsoftEvgeny Sokolov <evg@sw.ru> 1.0-1.swsoftSerguei Krasnov <krasnov@sw.ru> 1.0-1.swsoft- provides 2.6.10- chahged provides to 2.6.8- copied from fc4- createdkernelvzdummy-kernel-ce42.6.182.0-1.ce.swsoft-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9noarchnoarch-redhat-linux-gnucpiogzip9?e@}376ea3c3ef7d15deaaf00387fb61a28e1d4b0a3aL{|L{i,ƜUэh^1T0
#	(2YX5T..D
d^
x)GaF&,ƜUэh^&,ƜU$/var/lib/rpmrebuilddb.5717/PackagesGG(FDf gesT9$r{,|sj4kuY<ZvHDIwX''0	8~~	x@mmN
xH\\O
@*N
*@3K\=i`ih@aHPH
P?nKX..K`KhKp<xJ<K<M<N<O<P"<QsRbԉS<Q,RT@t"U$H|7P
8-X9`hpxTUCD2$3!,"4<DLT\	=iD\,qг|x!\gԢ'E044$}"(|T/XD\e@wdHfTh-,pܸptb|dxrd{SPpa|a $ O(08PQA?@B./C`ddqВ((0t;!C